(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE252

PENCW_10.PE252       Location/Qualifiers
FT   CDS             join(584952..585137,585248..585826)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209882" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949844"
FT                   /orf_name="Pc13g02520"
FT                   /product="Pc13g02520 protein"
FT                   /protein_id="CAP91321.1"
FT                   /db_xref="UniParc:UPI0001830C3F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1K4"
FT                   /transl_table=1
FT                   /translation="MTSGENYAVFRECLSNAIVARSEEKPTRRKPKVKRAERKDVKTAT
FT                   TFSTRRADPEELAEFVDFLASETFAIFPTPLQTLSYAAIQHDPSLSALYIPPDTDTPLP
FT                   RATLETIFSPIPVSVTDSLLVYGIIPDRADLVDFLAPVLTEYISSVTTGPPAWASTRAD
FT                   ACEICERDWIPLSYHHLIPRGVHAKVIKKGWHDEWMLNSVAWLCRACHSFVHRMASNEE
FT                   LAREWFTVERICEREDVQDWAKWVGRVRWKAR"
     MTSGENYAVF RECLSNAIVA RSEEKPTRRK PKVKRAERKD VKTATTFSTR RADPEELAEF        60
     VDFLASETFA IFPTPLQTLS YAAIQHDPSL SALYIPPDTD TPLPRATLET IFSPIPVSVT       120
     DSLLVYGIIP DRADLVDFLA PVLTEYISSV TTGPPAWAST RADACEICER DWIPLSYHHL       180
     IPRGVHAKVI KKGWHDEWML NSVAWLCRAC HSFVHRMASN EELAREWFTV ERICEREDVQ       240
     DWAKWVGRVR WKAR                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page