(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE253

PENCW_10.PE253       Location/Qualifiers
FT   CDS             join(complement(587890..588090),complement(586128..587858))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129236"
FT                   /orf_name="Pc13g02530"
FT                   /product="Pc13g02530 protein"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP91322.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR003566"
FT                   /db_xref="UniParc:UPI0001830C40"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1K5"
FT                   /transl_table=1
FT                   /translation="MLRFQFFLFLLLPWMASAGPIFRWLSPSLESPEPTSLPLLPDIER
FT                   REPGGITAITPVAAPTQLPFTPTIKPTKLTIFPKPTTTPEPTATPEPTTTPEPTATPEP
FT                   TTTPEPTTTPEPTATPEPTATPEPTTTPEPTTTPEPTTTPEPTATPEPTTTPEPTTTPE
FT                   PTATPEPTTTPEPTATPEPTTTQEQATTKKSTTISHASTTTRLSISSSTTPGVLHSSPI
FT                   TSSLPVHVPGSTSSLGSLVIPSSAQSPSDSLPGGATSIKATTATPSVSTSTSTQPTTTP
FT                   VPTVPTSSSIAVGAIAPLGGASSSSSSTSTPVIPTSNPIQPAKATQAQSTSLQQISTSS
FT                   SKPVVTVTEPVIVYVTKGAPKPFSTSVIHHTPSVNNSPVSSAKPTVKPSVEPTTTSLMF
FT                   VTIHSTATSVVRVTVYPSSSSSSSSSSSSSSSSSASSYSALSSSTGSAPSVNAAPIVLT
FT                   TINSATQSLSSSSLLLSSSSEIAPVVTAHVTSTSVVPLTVYPATSPPASSLLPPSSEAA
FT                   SIVTVRVTSTSVVPVTVYSTTSPSAPLLPSLSETAPVVTVHVTSTKTLLVTSYGSTATA
FT                   AETTHPADPTSAVDANIATPTSKQGQGILTVIPVTPPGFVTITETETETKTVTDRITET
FT                   VTATVTRG"
     MLRFQFFLFL LLPWMASAGP IFRWLSPSLE SPEPTSLPLL PDIERREPGG ITAITPVAAP        60
     TQLPFTPTIK PTKLTIFPKP TTTPEPTATP EPTTTPEPTA TPEPTTTPEP TTTPEPTATP       120
     EPTATPEPTT TPEPTTTPEP TTTPEPTATP EPTTTPEPTT TPEPTATPEP TTTPEPTATP       180
     EPTTTQEQAT TKKSTTISHA STTTRLSISS STTPGVLHSS PITSSLPVHV PGSTSSLGSL       240
     VIPSSAQSPS DSLPGGATSI KATTATPSVS TSTSTQPTTT PVPTVPTSSS IAVGAIAPLG       300
     GASSSSSSTS TPVIPTSNPI QPAKATQAQS TSLQQISTSS SKPVVTVTEP VIVYVTKGAP       360
     KPFSTSVIHH TPSVNNSPVS SAKPTVKPSV EPTTTSLMFV TIHSTATSVV RVTVYPSSSS       420
     SSSSSSSSSS SSSASSYSAL SSSTGSAPSV NAAPIVLTTI NSATQSLSSS SLLLSSSSEI       480
     APVVTAHVTS TSVVPLTVYP ATSPPASSLL PPSSEAASIV TVRVTSTSVV PVTVYSTTSP       540
     SAPLLPSLSE TAPVVTVHVT STKTLLVTSY GSTATAAETT HPADPTSAVD ANIATPTSKQ       600
     GQGILTVIPV TPPGFVTITE TETETKTVTD RITETVTATV TRG                         643
//

If you have problems or comments...

PBIL Back to PBIL home page