(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE254

PENCW_10.PE254       Location/Qualifiers
FT   CDS             join(complement(591057..591268),complement(588913..590995))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209915" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949845"
FT                   /orf_name="Pc13g02540"
FT                   /product="Pc13g02540 protein"
FT                   /protein_id="CAP91323.1"
FT                   /db_xref="InterPro:IPR006823"
FT                   /db_xref="UniParc:UPI0001830C41"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1K7"
FT                   /transl_table=1
FT                   /translation="MTNFRMGVTFAGVTLSVLVFLQLIAVFKLDSQPQSPLPGLSSNFN
FT                   QWKSRANAAAADDIFLVGAGKADVTGPVVEIAFAGYASLDQLGGGLKQRLYSRAFIFAD
FT                   PNKPDETFVYLVLDTLTGDTAVRHGVLEGLTALGGKYARYGEHNVAMTGTHSHSGPGAW
FT                   MNYLLPQIPALGFDKQSYQAIVDGAILSIIRAHENLVPGRLSFGSIDLEDTNINRSPFS
FT                   YEHNPDEERARYSANVEKSLSLIRFDRESDNKTAAILTWFPVHGTSMYNNNTLVSGDNK
FT                   GVAAYLFERSVDGDARFTDDAVIGFSQANVGDTSPNILGAWCEDGSEEMCRYEDSTCGG
FT                   RNEDCHGRGPFFREKDNGAKSCFEIGRRQYSAAKKLYEEMDTTPIKITGGSAVKSFHVY
FT                   QDMNGYTFPSPFNSSTLTTCPAALGYSFAAGTTDGPGAFDFTQNVTGPAGRNPLWKIAR
FT                   AVIHQPSKEQQQCQSPKNVLLDIGTLTEPYAWAADIIDIQVLRVGQLFLIISTSEATTM
FT                   SGRRWKEAIAKGAKDYLSVSDPLVVLGAPSNSYAHYVTTEEEYGAQRYEGGSTLYGPNT
FT                   LAAYVNLTLTYLPYLGSSLEVAKLPAIQPGPSPPINTNRSLSFIAGVVYDGAPIGKHFG
FT                   NVTSNPGSGPYGPGDIVKTTFVGANPRNNLHLESTYAAVERKNDYGTWEVVRNDRDWNL
FT                   VFTWKRTNEILGHSEVTIEWEIEDEYYSIDTTSPPQAGTYRMHYYGDSKNPLGQISPFE
FT                   GISGTFTVKTS"
     MTNFRMGVTF AGVTLSVLVF LQLIAVFKLD SQPQSPLPGL SSNFNQWKSR ANAAAADDIF        60
     LVGAGKADVT GPVVEIAFAG YASLDQLGGG LKQRLYSRAF IFADPNKPDE TFVYLVLDTL       120
     TGDTAVRHGV LEGLTALGGK YARYGEHNVA MTGTHSHSGP GAWMNYLLPQ IPALGFDKQS       180
     YQAIVDGAIL SIIRAHENLV PGRLSFGSID LEDTNINRSP FSYEHNPDEE RARYSANVEK       240
     SLSLIRFDRE SDNKTAAILT WFPVHGTSMY NNNTLVSGDN KGVAAYLFER SVDGDARFTD       300
     DAVIGFSQAN VGDTSPNILG AWCEDGSEEM CRYEDSTCGG RNEDCHGRGP FFREKDNGAK       360
     SCFEIGRRQY SAAKKLYEEM DTTPIKITGG SAVKSFHVYQ DMNGYTFPSP FNSSTLTTCP       420
     AALGYSFAAG TTDGPGAFDF TQNVTGPAGR NPLWKIARAV IHQPSKEQQQ CQSPKNVLLD       480
     IGTLTEPYAW AADIIDIQVL RVGQLFLIIS TSEATTMSGR RWKEAIAKGA KDYLSVSDPL       540
     VVLGAPSNSY AHYVTTEEEY GAQRYEGGST LYGPNTLAAY VNLTLTYLPY LGSSLEVAKL       600
     PAIQPGPSPP INTNRSLSFI AGVVYDGAPI GKHFGNVTSN PGSGPYGPGD IVKTTFVGAN       660
     PRNNLHLEST YAAVERKNDY GTWEVVRNDR DWNLVFTWKR TNEILGHSEV TIEWEIEDEY       720
     YSIDTTSPPQ AGTYRMHYYG DSKNPLGQIS PFEGISGTFT VKTS                        764
//

If you have problems or comments...

PBIL Back to PBIL home page