(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE256

PENCW_10.PE256       Location/Qualifiers
FT   CDS             join(complement(594779..595007),complement(593551..594722))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000209927" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949846"
FT                   /orf_name="Pc13g02560"
FT                   /product="Pc13g02560 protein"
FT                   /function="3-beta-hydroxy-delta5-steroid dehydrogenase
FT                   activity"
FT                   /function="binding"
FT                   /biological_process="steroid biosynthetic process "
FT                   /protein_id="CAP91325.1"
FT                   /db_xref="GO:0003854"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006694"
FT                   /db_xref="InterPro:IPR002225"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001830C43"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1K9"
FT                   /transl_table=1
FT                   /translation="MTWLIAAGLVGLGALYMWHVNSAMKIVPEEARKLSPHRWTVEEIE
FT                   AAYKKSMKAPIDVTKSLPPKQSRRYVIVGGNGLVGAWIVSHLLARGEDPKAIRILDIVS
FT                   PEQDVINKGVGWIKTNITDELAVTTAFEEPWVANVTNLPLTVYHTAAIIRPQDRLKSFL
FT                   PLSSKVNIDGTRNVLNAARAAGATAFIWTSSGSIALHQPTFWIAPWATQPKRVVQVVSD
FT                   STKLPESHDQFFGNYAVTKTEAERLVREADDPAINFRTGCIRPTNGVYGTGGQANNIIT
FT                   GVYLQNGGSPTWARPILQSFVHAENVSIAHLLYEQRLIQQSEPGSKLPNTGGQAFTVTD
FT                   PNPAIAFEDLYTLLTTLSRTPLAFPEVQPLPLLVMAYFIELYTFLQYKYLSWFLPRLSG
FT                   DIAQLQPSIFSIINVHVFADDSRARLAPEMGGLGYNPPLSTLEGLCRRLVDWNTKAERE
FT                   GVEAGTNM"
     MTWLIAAGLV GLGALYMWHV NSAMKIVPEE ARKLSPHRWT VEEIEAAYKK SMKAPIDVTK        60
     SLPPKQSRRY VIVGGNGLVG AWIVSHLLAR GEDPKAIRIL DIVSPEQDVI NKGVGWIKTN       120
     ITDELAVTTA FEEPWVANVT NLPLTVYHTA AIIRPQDRLK SFLPLSSKVN IDGTRNVLNA       180
     ARAAGATAFI WTSSGSIALH QPTFWIAPWA TQPKRVVQVV SDSTKLPESH DQFFGNYAVT       240
     KTEAERLVRE ADDPAINFRT GCIRPTNGVY GTGGQANNII TGVYLQNGGS PTWARPILQS       300
     FVHAENVSIA HLLYEQRLIQ QSEPGSKLPN TGGQAFTVTD PNPAIAFEDL YTLLTTLSRT       360
     PLAFPEVQPL PLLVMAYFIE LYTFLQYKYL SWFLPRLSGD IAQLQPSIFS IINVHVFADD       420
     SRARLAPEMG GLGYNPPLST LEGLCRRLVD WNTKAEREGV EAGTNM                      466
//

If you have problems or comments...

PBIL Back to PBIL home page