(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE257

PENCW_10.PE257       Location/Qualifiers
FT   CDS             join(596531..596862,596921..597297,597359..597635,
FT                   597699..598428)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160689" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129238"
FT                   /orf_name="Pc13g02570"
FT                   /product="Pc13g02570 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP91326.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001830C44"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1L0"
FT                   /transl_table=1
FT                   /translation="MAAQHSNSESQEKWPQNTETVSQDTDSIESVSTVETQTDRDALGK
FT                   TLTARASRTSHMSLSERVTTIATNATADPDYEVDWDGDDDPENPKNWNLKYKSMGIVFL
FT                   SWNTLIVVLYSTSYTSGITLMAEEFAQSGTIVTLGLTFYLFGLAIGSMFMAPLSEVYGR
FT                   KPVCVICLAVFTVLIIPCALAKSVTALIVVRFIAAFFGSVMISTAPGMVADLVDDEHRA
FT                   LAISVWSIGPLNGPVIGPVIGGFVTQYLGWRWMCWIALILSAIALVFAILLKETYAPTI
FT                   LQKKAARLRKETGESRWWSRYDQKASLPEILKLNLSRPFVMAVTEPICIFWNIYIAIIY
FT                   GILYLCFVAYPIVFRDIRGWQLGVSGLAFLGIGIGVLLTIACEPLIRRLVNSHPKDPET
FT                   GKPHPEAMVAFVCICATIIPVGELWFAWTCSPASIHWIVPILAGIPFGAGNTGVFIYAS
FT                   NYLTHSYGMYAASALAGNSVIRSILGGVLPLAGSSMYASLGPNWAGTLLGLLEVVIVPI
FT                   PFVFYKYGHKIRMKSPLIVRMQEEKTKLEGKRAKRQLRLQQVNQADEKKVEEAV"
     MAAQHSNSES QEKWPQNTET VSQDTDSIES VSTVETQTDR DALGKTLTAR ASRTSHMSLS        60
     ERVTTIATNA TADPDYEVDW DGDDDPENPK NWNLKYKSMG IVFLSWNTLI VVLYSTSYTS       120
     GITLMAEEFA QSGTIVTLGL TFYLFGLAIG SMFMAPLSEV YGRKPVCVIC LAVFTVLIIP       180
     CALAKSVTAL IVVRFIAAFF GSVMISTAPG MVADLVDDEH RALAISVWSI GPLNGPVIGP       240
     VIGGFVTQYL GWRWMCWIAL ILSAIALVFA ILLKETYAPT ILQKKAARLR KETGESRWWS       300
     RYDQKASLPE ILKLNLSRPF VMAVTEPICI FWNIYIAIIY GILYLCFVAY PIVFRDIRGW       360
     QLGVSGLAFL GIGIGVLLTI ACEPLIRRLV NSHPKDPETG KPHPEAMVAF VCICATIIPV       420
     GELWFAWTCS PASIHWIVPI LAGIPFGAGN TGVFIYASNY LTHSYGMYAA SALAGNSVIR       480
     SILGGVLPLA GSSMYASLGP NWAGTLLGLL EVVIVPIPFV FYKYGHKIRM KSPLIVRMQE       540
     EKTKLEGKRA KRQLRLQQVN QADEKKVEEA V                                      571
//

If you have problems or comments...

PBIL Back to PBIL home page