(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE259

PENCW_10.PE259       Location/Qualifiers
FT   CDS             join(599628..599802,599899..600103,600186..600394,
FT                   600452..600531)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209960" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949847"
FT                   /orf_name="Pc13g02590"
FT                   /product="Pc13g02590 protein"
FT                   /biological_process="protein transport"
FT                   /protein_id="CAP91328.1"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="UniParc:UPI0001830C45"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1L1"
FT                   /transl_table=1
FT                   /translation="MWSWFGGAAAQKRKDAPKNAILQLREQLDMLQKRERHLETQISEQ
FT                   EAMARKNVNSDKNAAKNALRRKKVHEKNLEQTTAQIMQLEQQIYSIEAANINHETLAAM
FT                   KQAGAAMKQIHGGMKLEDVDKTMEELQDQHALSAEIGSVITSFPIGEQPDEDELDAELG
FT                   NLEQEALDAKMLHTGPVPVGSQLDRLPAAGNTDLKQPAKAQEEDDEEAELAKLRAEMAM
FT                   "
     MWSWFGGAAA QKRKDAPKNA ILQLREQLDM LQKRERHLET QISEQEAMAR KNVNSDKNAA        60
     KNALRRKKVH EKNLEQTTAQ IMQLEQQIYS IEAANINHET LAAMKQAGAA MKQIHGGMKL       120
     EDVDKTMEEL QDQHALSAEI GSVITSFPIG EQPDEDELDA ELGNLEQEAL DAKMLHTGPV       180
     PVGSQLDRLP AAGNTDLKQP AKAQEEDDEE AELAKLRAEM AM                          222
//

If you have problems or comments...

PBIL Back to PBIL home page