(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE260

PENCW_10.PE260       Location/Qualifiers
FT   CDS             join(complement(605096..605144),complement(604844..604987),
FT                   complement(603847..604768),complement(603174..603786))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209961" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129239"
FT                   /orf_name="Pc13g02600"
FT                   /product="Pc13g02600 protein"
FT                   /protein_id="CAP91329.1"
FT                   /db_xref="InterPro:IPR013933"
FT                   /db_xref="UniParc:UPI0001830D07"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1E6"
FT                   /transl_table=1
FT                   /translation="MPRKLRAAAQAAAKSIKNVPSIPDGSDEEMVDVPSSHSSSPIAEQ
FT                   EDSPEKDPDVELEAEPESKQEELAAATPAGDSILADTDNTPSYGPGRPSLPPRGKRRIG
FT                   RPPKYPRPEWNPADGEQPLRVTTPVKRRRGRPAASGGRWARNRGPSHLTQVPVDKEGNM
FT                   MDVINDEVSIPPDPIGATKVDENGHLQGGREYRVRTFKILGRGDRLYMLSTEPARCIGF
FT                   RDSYLFFQKHKMLYKIIIDDDAKRDLIERDLIPHSYKGRAIGVVTARSVFREFGAKIIV
FT                   GGKKITDDYDEAAARERGDVEGELAVPEDRLPGPGETYNRNQYVAWHGASSVYHTNAPA
FT                   VPLVGGKPVDTKKRRVPVTDDNWMLEHARAASNFNSKLAEMRRKNLGGVYDVHTNIMQH
FT                   PKIMQPTHARWERVSPAPASVPTELTANMNLLNLSNGGSPSAHENQTSHETQESHEATT
FT                   GETATERLATTFSPVPAHLHDRCVIQDIVYESPPYSNMGIPGPDGDVHDIGPNGLVSVA
FT                   NPEHPEFMTPEILELLPPGCKEALVDAAAQEVEWKSKWTSETKDGERTQPTKSYAWYP"
     MPRKLRAAAQ AAAKSIKNVP SIPDGSDEEM VDVPSSHSSS PIAEQEDSPE KDPDVELEAE        60
     PESKQEELAA ATPAGDSILA DTDNTPSYGP GRPSLPPRGK RRIGRPPKYP RPEWNPADGE       120
     QPLRVTTPVK RRRGRPAASG GRWARNRGPS HLTQVPVDKE GNMMDVINDE VSIPPDPIGA       180
     TKVDENGHLQ GGREYRVRTF KILGRGDRLY MLSTEPARCI GFRDSYLFFQ KHKMLYKIII       240
     DDDAKRDLIE RDLIPHSYKG RAIGVVTARS VFREFGAKII VGGKKITDDY DEAAARERGD       300
     VEGELAVPED RLPGPGETYN RNQYVAWHGA SSVYHTNAPA VPLVGGKPVD TKKRRVPVTD       360
     DNWMLEHARA ASNFNSKLAE MRRKNLGGVY DVHTNIMQHP KIMQPTHARW ERVSPAPASV       420
     PTELTANMNL LNLSNGGSPS AHENQTSHET QESHEATTGE TATERLATTF SPVPAHLHDR       480
     CVIQDIVYES PPYSNMGIPG PDGDVHDIGP NGLVSVANPE HPEFMTPEIL ELLPPGCKEA       540
     LVDAAAQEVE WKSKWTSETK DGERTQPTKS YAWYP                                  575
//

If you have problems or comments...

PBIL Back to PBIL home page