(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE261

PENCW_10.PE261       Location/Qualifiers
FT   CDS             join(complement(607012..607260),complement(606585..606821),
FT                   complement(606459..606536))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824875"
FT                   /orf_name="Pc13g02610"
FT                   /product="Putative uncharacterized protein Pc13g02610 "
FT                   /protein_id="CAP91330.1"
FT                   /db_xref="UniParc:UPI0001830D08"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1E7"
FT                   /transl_table=1
FT                   /translation="MIAFFRSRSIVRMTVRPRTCGYTRVPYQKRLRGITNSPLSMRPFP
FT                   FDFDTCTYLSFPSLIALRISISTLTAGYLILASDDNIGIKSSFTHREIVTTFSFQYGPG
FT                   RALSSPCICIPGEIVRYAVVAVGRSQASTCVIGARREVPASALTCGSADLRPGSCMNDK
FT                   EKETLESFADLRFGPSDYSIHGLE"
     MIAFFRSRSI VRMTVRPRTC GYTRVPYQKR LRGITNSPLS MRPFPFDFDT CTYLSFPSLI        60
     ALRISISTLT AGYLILASDD NIGIKSSFTH REIVTTFSFQ YGPGRALSSP CICIPGEIVR       120
     YAVVAVGRSQ ASTCVIGARR EVPASALTCG SADLRPGSCM NDKEKETLES FADLRFGPSD       180
     YSIHGLE                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page