(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE265

PENCW_10.PE265       Location/Qualifiers
FT   CDS             join(614937..615027,615180..615410,615515..615555,
FT                   615838..615948)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949849"
FT                   /orf_name="Pc13g02650"
FT                   /product="Putative uncharacterized protein Pc13g02650 "
FT                   /protein_id="CAP91334.1"
FT                   /db_xref="UniParc:UPI0001830D0B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1D2"
FT                   /transl_table=1
FT                   /translation="MFQRGYRKTSSQRKTAQSVACSRQSYGSGPVDAQRDQDVIEGVAT
FT                   GRPGSVPGYLLAALMHCPKLLEGISDGDWRHFEGEERAEELAESDRTQKALVLVADRKA
FT                   CEEGEPLSEIVDNEDEDGRLTLVCGAPQAQDAAQDAARGPVGRSGLAVRGGPG"
     MFQRGYRKTS SQRKTAQSVA CSRQSYGSGP VDAQRDQDVI EGVATGRPGS VPGYLLAALM        60
     HCPKLLEGIS DGDWRHFEGE ERAEELAESD RTQKALVLVA DRKACEEGEP LSEIVDNEDE       120
     DGRLTLVCGA PQAQDAAQDA ARGPVGRSGL AVRGGPG                                157
//

If you have problems or comments...

PBIL Back to PBIL home page