(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE266

PENCW_10.PE266       Location/Qualifiers
FT   CDS             616696..617133
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234873" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949850"
FT                   /orf_name="Pc13g02660"
FT                   /product="Pc13g02660 protein"
FT                   /protein_id="CAP91335.1"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniParc:UPI0001830D0C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1D3"
FT                   /transl_table=1
FT                   /translation="MTSKPKPAILPSTYTRTTPPETFPTPGHGDISWHTLISSPQTEST
FT                   DLCAGIATCPPATGHLCAHRHTQSEIYHILEGEGNVTIDGVVSRVQAGSTVFIPSDAEH
FT                   GIVNTGPADLRWFYVFPTGSFGDVVYRFTEDEGEAKGKAKL"
     MTSKPKPAIL PSTYTRTTPP ETFPTPGHGD ISWHTLISSP QTESTDLCAG IATCPPATGH        60
     LCAHRHTQSE IYHILEGEGN VTIDGVVSRV QAGSTVFIPS DAEHGIVNTG PADLRWFYVF       120
     PTGSFGDVVY RFTEDEGEAK GKAKL                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page