(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE267

PENCW_10.PE267       Location/Qualifiers
FT   CDS             join(618980..619365,619447..621352)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209983" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949851"
FT                   /orf_name="Pc13g02670"
FT                   /product="Pc13g02670 protein"
FT                   /protein_id="CAP91336.1"
FT                   /db_xref="UniParc:UPI0001830D0D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1D4"
FT                   /transl_table=1
FT                   /translation="MSVVATRTETPVVSYNSIPENHVDYTVHSRTSSISSYRTNYTTST
FT                   APTTYSPSSPSSSYRQCDSVNSLPKLTEPIQRRVPHEVYEVIINHLEELHKGQHQTGCT
FT                   TCFQRDLHALSLTCRSWEKAVRGPLYHSIHIVGNDSPAQLKKYRLKRGSRLKLLRRTLR
FT                   ERKLLANLVYELRVPQLDLLFTTTKQGPQWQEYRDLVASVVMVCPNLERLLGLSIPYHH
FT                   EFDRLTHALSTRKKLKEHTWVLGEPAEVSELSPRDDSCPGSLGPSQMFEFLNYHTSWTS
FT                   LETMMLYGLNGNGALEPSISLRMFNLLPSLRNLCITSFNKDSFDDNTLMCLPPLESLRL
FT                   ENLPGITDAGLSQYTSRPESLSLRTLVLIEQNVESLLVISKILASLRGLERFKIVQTGK
FT                   CPTLPGDHMIFQPILASSTLKYLHWDVACPDPGTALTQLDTLPFQKPTKPSNTPNYHLA
FT                   QSIISAGFPQLEALRAPSDVEPPGALQAVCRPILKGQALLRPDRYSLPRSSHGSVNTRP
FT                   LALPAGNNLTSARIRAQTFIDMAAKDTEAGMPVLIQDYSDSYVPDNAQNSQFEDDPDQE
FT                   MDDYGIWAACERFKHKDNDHNGPKTVYEFRMPTLMGRSGFRDPATGASIPHFILRPDIP
FT                   GQELDGGLIGWKQLLASNQSLSYAAGVGVNCFNSGNPSIPPPEEPMSPSSSISRFGWGS
FT                   LSGRSMTGTSPTTPTTPLMPTSSASGSALPWEKDTCTGTWNHKAGRDWWFHMERDRPGN
FT                   SELVDIKQLF"
     MSVVATRTET PVVSYNSIPE NHVDYTVHSR TSSISSYRTN YTTSTAPTTY SPSSPSSSYR        60
     QCDSVNSLPK LTEPIQRRVP HEVYEVIINH LEELHKGQHQ TGCTTCFQRD LHALSLTCRS       120
     WEKAVRGPLY HSIHIVGNDS PAQLKKYRLK RGSRLKLLRR TLRERKLLAN LVYELRVPQL       180
     DLLFTTTKQG PQWQEYRDLV ASVVMVCPNL ERLLGLSIPY HHEFDRLTHA LSTRKKLKEH       240
     TWVLGEPAEV SELSPRDDSC PGSLGPSQMF EFLNYHTSWT SLETMMLYGL NGNGALEPSI       300
     SLRMFNLLPS LRNLCITSFN KDSFDDNTLM CLPPLESLRL ENLPGITDAG LSQYTSRPES       360
     LSLRTLVLIE QNVESLLVIS KILASLRGLE RFKIVQTGKC PTLPGDHMIF QPILASSTLK       420
     YLHWDVACPD PGTALTQLDT LPFQKPTKPS NTPNYHLAQS IISAGFPQLE ALRAPSDVEP       480
     PGALQAVCRP ILKGQALLRP DRYSLPRSSH GSVNTRPLAL PAGNNLTSAR IRAQTFIDMA       540
     AKDTEAGMPV LIQDYSDSYV PDNAQNSQFE DDPDQEMDDY GIWAACERFK HKDNDHNGPK       600
     TVYEFRMPTL MGRSGFRDPA TGASIPHFIL RPDIPGQELD GGLIGWKQLL ASNQSLSYAA       660
     GVGVNCFNSG NPSIPPPEEP MSPSSSISRF GWGSLSGRSM TGTSPTTPTT PLMPTSSASG       720
     SALPWEKDTC TGTWNHKAGR DWWFHMERDR PGNSELVDIK QLF                         763
//

If you have problems or comments...

PBIL Back to PBIL home page