(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE268

PENCW_10.PE268       Location/Qualifiers
FT   CDS             622004..623950
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000259232" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949852"
FT                   /orf_name="Pc13g02680"
FT                   /product="Pc13g02680 protein"
FT                   /function="ATP binding"
FT                   /function="glutamine-tRNA ligase activity"
FT                   /biological_process="glutaminyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP91337.1"
FT                   /db_xref="GO:0004819"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006425"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004514"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020059"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="UniParc:UPI0001830D0E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1D5"
FT                   /transl_table=1
FT                   /translation="MDPAKPVDLPERPKEATEPTVPPKKSKSQEKKEAAAAKKAAAKLA
FT                   AKQDQPKSKGEPKAPKAKEAPAPRDPQAMFKVGFLHDVYQEKPLSETVPKIRTRFPPEP
FT                   NGYLHIGHSKAIAINFGFAKYHGGECILRFDDTNPEGEEERYYNAIREIVTWLGFTPVR
FT                   ETNASDNFDRLYELAEDLIQRDGAYVCHCTKAEIKAQRGEVEGGQRGGERFACSHRTRP
FT                   IEESMAEFRAMRDGKYKAGEAALRMKQDITDPNPQMWDLFAWRIMGSEDKQHHLTGGKW
FT                   KIYPTYDFAHCLCDSIEEISHSLCTTEFELSRVSYEWLCDKLEVYRPNQREYGRLNITG
FT                   TVLSKRKIIQLVKEGHVRDWDDPRLYTLIALRRRGVPPGAILSFVNDLGVTKNTTNVQV
FT                   TKFEQIVRQYLETTVPRLMVVLEPLKVIIDDLPEDHLELIDCPFSKDPAFGTHDIPFTK
FT                   TVYIERSDFRAVDSPDYFRLAPGKTVGLLKVPYPITATSFETDPATGEVTCVHAKYEKP
FT                   AEGEAPVKPKSFIHWIGESPAHNSPIRAEVRAFNSLFKSEDPSAHPAGFLADINPDSEE
FT                   IFKDAMVETGFRDISRSAPWPKEEGAGEPGENKHSIRFQGMRVAYFAVDRESTDEKLVL
FT                   NRIVTLKDTQGKN"
     MDPAKPVDLP ERPKEATEPT VPPKKSKSQE KKEAAAAKKA AAKLAAKQDQ PKSKGEPKAP        60
     KAKEAPAPRD PQAMFKVGFL HDVYQEKPLS ETVPKIRTRF PPEPNGYLHI GHSKAIAINF       120
     GFAKYHGGEC ILRFDDTNPE GEEERYYNAI REIVTWLGFT PVRETNASDN FDRLYELAED       180
     LIQRDGAYVC HCTKAEIKAQ RGEVEGGQRG GERFACSHRT RPIEESMAEF RAMRDGKYKA       240
     GEAALRMKQD ITDPNPQMWD LFAWRIMGSE DKQHHLTGGK WKIYPTYDFA HCLCDSIEEI       300
     SHSLCTTEFE LSRVSYEWLC DKLEVYRPNQ REYGRLNITG TVLSKRKIIQ LVKEGHVRDW       360
     DDPRLYTLIA LRRRGVPPGA ILSFVNDLGV TKNTTNVQVT KFEQIVRQYL ETTVPRLMVV       420
     LEPLKVIIDD LPEDHLELID CPFSKDPAFG THDIPFTKTV YIERSDFRAV DSPDYFRLAP       480
     GKTVGLLKVP YPITATSFET DPATGEVTCV HAKYEKPAEG EAPVKPKSFI HWIGESPAHN       540
     SPIRAEVRAF NSLFKSEDPS AHPAGFLADI NPDSEEIFKD AMVETGFRDI SRSAPWPKEE       600
     GAGEPGENKH SIRFQGMRVA YFAVDRESTD EKLVLNRIVT LKDTQGKN                    648
//

If you have problems or comments...

PBIL Back to PBIL home page