(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE269

PENCW_10.PE269       Location/Qualifiers
FT   CDS             join(complement(625794..626107),complement(625250..625665),
FT                   complement(624530..625188))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000225143" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672171"
FT                   /orf_name="Pc13g02690"
FT                   /product="Pc13g02690 protein"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="protein catabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP91338.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="GO:0030163"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="UniParc:UPI0001830D0F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1D6"
FT                   /transl_table=1
FT                   /translation="MSTLEDLDDLEQEQRDKKQDQNDGDGKKPEGDGDADMKDADKNDE
FT                   EEEMLDEDILNSSTADIVTRRRMLENEMRIMKSEFQRLTHEQSTMREKVKDNQEKIENN
FT                   RQLPYLVGNVVELLDLDVEAEAAEEGANIDLDATRVGKSAVIKTSTRQTIFLPLIGLVD
FT                   HETLKPGDLIGVNKDSYLILDTLPAEYDNRVKAMEVDEKPTEKYTDIGGLDKQIEEIVE
FT                   AIVWPMKEAERFKKIGIKAPKGALMYGPPGTGKTLLARACAAETNATFLKLAGPQLVQM
FT                   FIGDGAKLVRDCFALAKEKAPSIIFIDELDAVGTKRFDSEKSGDREVQRTMLELLNQLD
FT                   GFASDDRIKVLAATNRVDVLDPALLRSGRLDRKIEFPLPNEEARANILQIHSRKMSVED
FT                   SVNWAELARSTDEFGGAQLKAVCVEAGMIALRKGQSKIGHENYVDAIAEVQAKKKDTNM
FT                   GIYV"
     MSTLEDLDDL EQEQRDKKQD QNDGDGKKPE GDGDADMKDA DKNDEEEEML DEDILNSSTA        60
     DIVTRRRMLE NEMRIMKSEF QRLTHEQSTM REKVKDNQEK IENNRQLPYL VGNVVELLDL       120
     DVEAEAAEEG ANIDLDATRV GKSAVIKTST RQTIFLPLIG LVDHETLKPG DLIGVNKDSY       180
     LILDTLPAEY DNRVKAMEVD EKPTEKYTDI GGLDKQIEEI VEAIVWPMKE AERFKKIGIK       240
     APKGALMYGP PGTGKTLLAR ACAAETNATF LKLAGPQLVQ MFIGDGAKLV RDCFALAKEK       300
     APSIIFIDEL DAVGTKRFDS EKSGDREVQR TMLELLNQLD GFASDDRIKV LAATNRVDVL       360
     DPALLRSGRL DRKIEFPLPN EEARANILQI HSRKMSVEDS VNWAELARST DEFGGAQLKA       420
     VCVEAGMIAL RKGQSKIGHE NYVDAIAEVQ AKKKDTNMGI YV                          462
//

If you have problems or comments...

PBIL Back to PBIL home page