(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE27

PENCW_10.PE27        Location/Qualifiers
FT   CDS             join(64208..64216,64262..64361,64411..64622,64681..64765,
FT                   64978..65000,65070..65122,65198..65267,65476..65773,
FT                   65850..66010)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948690"
FT                   /orf_name="Pc13g00270"
FT                   /product="Pc13g00270 protein"
FT                   /protein_id="CAP91096.1"
FT                   /db_xref="UniParc:UPI0001830DC2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H175"
FT                   /transl_table=1
FT                   /translation="MSQILDGLCYLSSFGLTHQSLSCGGILLGTNGRVKIACLDQCSEC
FT                   SPTETYTIYANTIPRITMALMQKHEKDVGIAGVNDLNQWPVDSDAFGFLSAASTEPIES
FT                   LRKHPLVAARNQPTEDLVMLARAVLCAWVSKMHITLAIIPSGHEYVYIHCVPPVAIFLF
FT                   RDYHVRLAVHYLGSLEQSHYIVNKWNRTINDLCTQVTKWSLVKANNTVLEEILRRDRIL
FT                   RRNPEQSQRSAGSPFPLESAEEPAISTPPQVDAGSLDGMAIETQRTDAQASASKRGAGT
FT                   RNFLKHKAWPAEVLKRLPLWFEDQVRKNQSQEELMQSVAPSMLSVVSIRLVDGKR"
     MSQILDGLCY LSSFGLTHQS LSCGGILLGT NGRVKIACLD QCSECSPTET YTIYANTIPR        60
     ITMALMQKHE KDVGIAGVND LNQWPVDSDA FGFLSAASTE PIESLRKHPL VAARNQPTED       120
     LVMLARAVLC AWVSKMHITL AIIPSGHEYV YIHCVPPVAI FLFRDYHVRL AVHYLGSLEQ       180
     SHYIVNKWNR TINDLCTQVT KWSLVKANNT VLEEILRRDR ILRRNPEQSQ RSAGSPFPLE       240
     SAEEPAISTP PQVDAGSLDG MAIETQRTDA QASASKRGAG TRNFLKHKAW PAEVLKRLPL       300
     WFEDQVRKNQ SQEELMQSVA PSMLSVVSIR LVDGKR                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page