(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE271

PENCW_10.PE271       Location/Qualifiers
FT   CDS             join(complement(629709..629828),complement(629228..629654),
FT                   complement(629079..629172),complement(628667..629009))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000044064" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949854"
FT                   /orf_name="Pc13g02710"
FT                   /product="Pc13g02710 protein"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="CAP91340.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="UniParc:UPI0001830D11"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1D8"
FT                   /transl_table=1
FT                   /translation="MSAPGAGHEFPAQEVSWQKRDVLLFANSIGVKADELHFLYELHPN
FT                   FAVFPTYSLILRMSKNTSDFRTIALTPKPLAFKLTDQEVTDFYARQKAVHIPGVPDLDH
FT                   RHGVDGQRKITILKPLPTTSAGRKFELRNKVIGVYDKGKPGTVIETEQSIVDKESGEVY
FT                   SKVVSSGFLVGQGGWGGPKGPSTVNYAPPEGRAPDATHVVQSNSETAHLYRLNGDYNPL
FT                   HATPEPGQKMGFGGIIIHGLFSWNSAAHGILREFGGSNPANMKEFQARFASPVRPGDKL
FT                   TTEIWRMGNIQDGYEEIRFVTKNDKGRVVLSNGRCLLKVTGVKSKL"
     MSAPGAGHEF PAQEVSWQKR DVLLFANSIG VKADELHFLY ELHPNFAVFP TYSLILRMSK        60
     NTSDFRTIAL TPKPLAFKLT DQEVTDFYAR QKAVHIPGVP DLDHRHGVDG QRKITILKPL       120
     PTTSAGRKFE LRNKVIGVYD KGKPGTVIET EQSIVDKESG EVYSKVVSSG FLVGQGGWGG       180
     PKGPSTVNYA PPEGRAPDAT HVVQSNSETA HLYRLNGDYN PLHATPEPGQ KMGFGGIIIH       240
     GLFSWNSAAH GILREFGGSN PANMKEFQAR FASPVRPGDK LTTEIWRMGN IQDGYEEIRF       300
     VTKNDKGRVV LSNGRCLLKV TGVKSKL                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page