(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE272

PENCW_10.PE272       Location/Qualifiers
FT   CDS             join(complement(631740..631831),complement(631670..631683),
FT                   complement(631573..631592),complement(631398..631507),
FT                   complement(631007..631338),complement(630476..630951))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000198521" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672172"
FT                   /orf_name="Pc13g02720"
FT                   /product="Pc13g02720 protein"
FT                   /function="protein methyltransferase activity"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP91341.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008276"
FT                   /db_xref="InterPro:IPR010456"
FT                   /db_xref="UniParc:UPI0001830D12"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1D9"
FT                   /transl_table=1
FT                   /translation="MDTESDSPQGITSSADRMVGMEHSEVRYFTSYDHHGIHEEMLKDD
FT                   VRTRSYRDSIYQNRHIFKDKVVLDVGCGTGILSMFAARAGAKHVIGVDMSSIIEKARQI
FT                   VEVNGLSDKITLLQGKMEEVNLPFPKVDIIISEWMGYFLLYESMLDTVLYARDTYLNPG
FT                   GLIFPDKATMYVAGIEDGDYKDDKIGFWDNVYGFDYSPMKEIALNEPLVDTVEMKALVT
FT                   DPCAIITFDLNTVTTADLAFKVPYALTAKRPDFIHALIAWFDIEFSACHKPIHFSTGPH
FT                   AKYTHWKQTVFYLRDVLTVEEDERVTGWVENRPNDKNKRDLDISISYKFETPDATRAAE
FT                   GGCFYRM"
     MDTESDSPQG ITSSADRMVG MEHSEVRYFT SYDHHGIHEE MLKDDVRTRS YRDSIYQNRH        60
     IFKDKVVLDV GCGTGILSMF AARAGAKHVI GVDMSSIIEK ARQIVEVNGL SDKITLLQGK       120
     MEEVNLPFPK VDIIISEWMG YFLLYESMLD TVLYARDTYL NPGGLIFPDK ATMYVAGIED       180
     GDYKDDKIGF WDNVYGFDYS PMKEIALNEP LVDTVEMKAL VTDPCAIITF DLNTVTTADL       240
     AFKVPYALTA KRPDFIHALI AWFDIEFSAC HKPIHFSTGP HAKYTHWKQT VFYLRDVLTV       300
     EEDERVTGWV ENRPNDKNKR DLDISISYKF ETPDATRAAE GGCFYRM                     347
//

If you have problems or comments...

PBIL Back to PBIL home page