(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE273

PENCW_10.PE273       Location/Qualifiers
FT   CDS             join(632518..632643,632693..633567,633629..633683)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000210016" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129240"
FT                   /orf_name="Pc13g02730"
FT                   /product="Pc13g02730 protein"
FT                   /protein_id="CAP91342.1"
FT                   /db_xref="InterPro:IPR007217"
FT                   /db_xref="UniParc:UPI0001830D13"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1E0"
FT                   /transl_table=1
FT                   /translation="MNLGVGRANLYTLFAFVFLASLIGKSNASLGDHLPDFKECVQVCK
FT                   TENCQNGNSVLRMSNHHPNSSPRLALLTSLALHHRLLLWTCPAECDYTCQHVITDRRVS
FT                   RDPPMISPIVQFHGKWPFRRLLGMQEPFSVLFSFFNFAAHWHGMSRIQESIPAWHSLRP
FT                   YYMMFGYIGLASWSFSMIFHMRDFPLTEKLDYWAAGANVLYGLYLAVVRIFRLDLENTP
FT                   YRPTLRRFWTAICILLYTLHVGYLTFWSWDYTYNMIANVVVGIIQNLMWTGFSIFRYRR
FT                   LEKSWAAWPGMIVAWIIMAMSLELLDFPPWNGLIDAHSLWHLGTVVPAVWWYSFLIKDA
FT                   QDDIAAHRLKA"
     MNLGVGRANL YTLFAFVFLA SLIGKSNASL GDHLPDFKEC VQVCKTENCQ NGNSVLRMSN        60
     HHPNSSPRLA LLTSLALHHR LLLWTCPAEC DYTCQHVITD RRVSRDPPMI SPIVQFHGKW       120
     PFRRLLGMQE PFSVLFSFFN FAAHWHGMSR IQESIPAWHS LRPYYMMFGY IGLASWSFSM       180
     IFHMRDFPLT EKLDYWAAGA NVLYGLYLAV VRIFRLDLEN TPYRPTLRRF WTAICILLYT       240
     LHVGYLTFWS WDYTYNMIAN VVVGIIQNLM WTGFSIFRYR RLEKSWAAWP GMIVAWIIMA       300
     MSLELLDFPP WNGLIDAHSL WHLGTVVPAV WWYSFLIKDA QDDIAAHRLK A                351
//

If you have problems or comments...

PBIL Back to PBIL home page