(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE274

PENCW_10.PE274       Location/Qualifiers
FT   CDS             join(634098..634190,634259..634272,634379..634523,
FT                   634597..634611,634672..635163,635219..636079)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000210027" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129241"
FT                   /orf_name="Pc13g02740"
FT                   /product="Pc13g02740 protein"
FT                   /function="magnesium ion binding"
FT                   /function="phosphoacetylglucosamine mutase activity "
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAP91343.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004610"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR016657"
FT                   /db_xref="UniParc:UPI0001830D14"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1E1"
FT                   /transl_table=1
FT                   /translation="MASPAVKKAITEAALQYAKPEGKVFEYGTAGFRMKADLLNTVVFA
FT                   VGLLASLRSKKLSGQWIGVMVTASHNPAEDNGVKLVDPMGEMLEAEWEAYATRLANAPL
FT                   DKIADVYDELIKEIDVKMTNPARVVFARDTRASGSRLVGVLNAALTATEVEFVDLKYMT
FT                   TPQLHYVVRCKNTLGTQYEYGEPTEQGYYEKLANSFKKVMRGVKVQGSLTVDCANGVGG
FT                   PKLRELMKYLTGIDIKVVNDDVINPDALNFDCGADYVKTKQRAPPSSKAAVLDRCASLD
FT                   GDADRLVYYFLDESNVFRLLDGDRIATLAASFIGDLARNAGIASKLKIGVVQTAYANGA
FT                   STDYIEKVLKLPIICTNTGVKHLHHAALRFDVGVYFEANGHGTVTFSENALKVIKNTEP
FT                   QSPAQQHALESLQALTDLINQAVGDALSDALLVEAILAHKGWSPKEWLGTYTDLPSRLV
FT                   RVEVNDRSIFKAYDAERKLESPPGLQGTIESLQSRYNKGRSFARASGTEDAVRVYAEAA
FT                   SRSEADDLATRVANAVSEAGSA"
     MASPAVKKAI TEAALQYAKP EGKVFEYGTA GFRMKADLLN TVVFAVGLLA SLRSKKLSGQ        60
     WIGVMVTASH NPAEDNGVKL VDPMGEMLEA EWEAYATRLA NAPLDKIADV YDELIKEIDV       120
     KMTNPARVVF ARDTRASGSR LVGVLNAALT ATEVEFVDLK YMTTPQLHYV VRCKNTLGTQ       180
     YEYGEPTEQG YYEKLANSFK KVMRGVKVQG SLTVDCANGV GGPKLRELMK YLTGIDIKVV       240
     NDDVINPDAL NFDCGADYVK TKQRAPPSSK AAVLDRCASL DGDADRLVYY FLDESNVFRL       300
     LDGDRIATLA ASFIGDLARN AGIASKLKIG VVQTAYANGA STDYIEKVLK LPIICTNTGV       360
     KHLHHAALRF DVGVYFEANG HGTVTFSENA LKVIKNTEPQ SPAQQHALES LQALTDLINQ       420
     AVGDALSDAL LVEAILAHKG WSPKEWLGTY TDLPSRLVRV EVNDRSIFKA YDAERKLESP       480
     PGLQGTIESL QSRYNKGRSF ARASGTEDAV RVYAEAASRS EADDLATRVA NAVSEAGSA        539
//

If you have problems or comments...

PBIL Back to PBIL home page