(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE276

PENCW_10.PE276       Location/Qualifiers
FT   CDS             join(638108..638308,638359..639501)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210038" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949855"
FT                   /orf_name="Pc13g02760"
FT                   /product="Pc13g02760 protein"
FT                   /protein_id="CAP91345.1"
FT                   /db_xref="InterPro:IPR007109"
FT                   /db_xref="UniParc:UPI0001830DCE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1E3"
FT                   /transl_table=1
FT                   /translation="MAKQRVKKRTHQKPQNASAVKGSTASMSKTPKSMVIRVGASQVGS
FT                   SVTQLVKDVRRMMEPDTAVRLKERKSNRLRDYTVMTGPLGVTHLMLFSKSATGNTNMRL
FT                   AVTPRGPTLHFKVENYSLCKDVERSMKRPKSGGQDHKTPPLLVMNNFTTPDATEESKVP
FT                   KRLETLTTTIFQSLFPPINPQNQPLSSIRRVMLLNREPAEKDSDSYILTLRHYAIATKK
FT                   TGVSKRIRRLDPKEIRNRDKKKTAVPNLGKLEDAADYLLDPSAAGYTSASETELDTDAE
FT                   VEVQESATRRVLNKREMQRQKAAEKGQDKPAHTTGVEKRAVKLVELGPRLRLRLMKVED
FT                   GVCDGKVMWHDFITKSEKEMRKMDQSWDVRRKEKEQRKKLQKENIERKKQEKAKARGSG
FT                   KEVAEEDEDEDMDDEDWLSDDDFEKDAEGEGEPADDDSEADSDESMEE"
     MAKQRVKKRT HQKPQNASAV KGSTASMSKT PKSMVIRVGA SQVGSSVTQL VKDVRRMMEP        60
     DTAVRLKERK SNRLRDYTVM TGPLGVTHLM LFSKSATGNT NMRLAVTPRG PTLHFKVENY       120
     SLCKDVERSM KRPKSGGQDH KTPPLLVMNN FTTPDATEES KVPKRLETLT TTIFQSLFPP       180
     INPQNQPLSS IRRVMLLNRE PAEKDSDSYI LTLRHYAIAT KKTGVSKRIR RLDPKEIRNR       240
     DKKKTAVPNL GKLEDAADYL LDPSAAGYTS ASETELDTDA EVEVQESATR RVLNKREMQR       300
     QKAAEKGQDK PAHTTGVEKR AVKLVELGPR LRLRLMKVED GVCDGKVMWH DFITKSEKEM       360
     RKMDQSWDVR RKEKEQRKKL QKENIERKKQ EKAKARGSGK EVAEEDEDED MDDEDWLSDD       420
     DFEKDAEGEG EPADDDSEAD SDESMEE                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page