(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE277

PENCW_10.PE277       Location/Qualifiers
FT   CDS             join(complement(640816..640846),complement(640641..640763),
FT                   complement(640039..640586))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000151757" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949856"
FT                   /orf_name="Pc13g02770"
FT                   /product="Pc13g02770 protein"
FT                   /protein_id="CAP91346.1"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="UniParc:UPI0001830DCF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1E4"
FT                   /transl_table=1
FT                   /translation="MFTGLVETIGTVTALEPIDTSSSGGGGTSLTISDCEEILTDAHLG
FT                   DSIAVNGTCLTVTAFDKTWFKVGCAPETLRRTNLGSLQANSNVNLERAVSADTRMGGHF
FT                   VQGHVDTVAEILSVTPDGNSLVFRLQPRDRDILRYVVEKGYVTLDGASLTVTKVVDGQD
FT                   GYWEVMLIAYTQGKVVTAAKKPGDLVNVEIDIVGKYVEKSVQGYFAGTSGGDFAILEKM
FT                   VNRIVDERLKK"
     MFTGLVETIG TVTALEPIDT SSSGGGGTSL TISDCEEILT DAHLGDSIAV NGTCLTVTAF        60
     DKTWFKVGCA PETLRRTNLG SLQANSNVNL ERAVSADTRM GGHFVQGHVD TVAEILSVTP       120
     DGNSLVFRLQ PRDRDILRYV VEKGYVTLDG ASLTVTKVVD GQDGYWEVML IAYTQGKVVT       180
     AAKKPGDLVN VEIDIVGKYV EKSVQGYFAG TSGGDFAILE KMVNRIVDER LKK              233
//

If you have problems or comments...

PBIL Back to PBIL home page