(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE278

PENCW_10.PE278       Location/Qualifiers
FT   CDS             join(641042..641215,641274..641305,641380..641503,
FT                   641563..642067,642127..642420,642479..642690)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000219745" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824876"
FT                   /orf_name="Pc13g02780"
FT                   /product="Pc13g02780 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP91347.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="UniParc:UPI0001830DD0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1E5"
FT                   /transl_table=1
FT                   /translation="MTVALRFQVAARRSGLSWGSNALRRTIPGRSYSSAVAADGSLPLA
FT                   GIRVLDMTRVLAGPYCTQXLGDLGADVIKVEHPVRGDDTRAWGPPYAKYEDASRKGPGE
FT                   SAYYLAVNRNKKSLGLSFQHKSGVEILHKLAKECDVLVENYLPGGLKKYGMDYETLREI
FT                   NPKLIYASITGYGQTGPYSNRAGYDVMVEAEMGLMHITGARDGAPVKVGVAVTDLTTGL
FT                   YTSNAIMAALIARGRTGRGQHIDACLSDCQVATLSNLASSALISGQKDSGRWGTAHPSI
FT                   VPYRSYKTSDGDILFGGGNDKLFGVLCDRLGFSEWKTDARFVTNSDRVQHRAEIDGMIE
FT                   STTMQKTTQEWLDIFEGSGMPYAAVNDIQGTLNHKHVLARDMVTEVEHPACGPIKLVNT
FT                   PIKYSEATPGVRTPPPTLGQHTDEILGSVLDYGEADIARLKDEGVVS"
     MTVALRFQVA ARRSGLSWGS NALRRTIPGR SYSSAVAADG SLPLAGIRVL DMTRVLAGPY        60
     CTQXLGDLGA DVIKVEHPVR GDDTRAWGPP YAKYEDASRK GPGESAYYLA VNRNKKSLGL       120
     SFQHKSGVEI LHKLAKECDV LVENYLPGGL KKYGMDYETL REINPKLIYA SITGYGQTGP       180
     YSNRAGYDVM VEAEMGLMHI TGARDGAPVK VGVAVTDLTT GLYTSNAIMA ALIARGRTGR       240
     GQHIDACLSD CQVATLSNLA SSALISGQKD SGRWGTAHPS IVPYRSYKTS DGDILFGGGN       300
     DKLFGVLCDR LGFSEWKTDA RFVTNSDRVQ HRAEIDGMIE STTMQKTTQE WLDIFEGSGM       360
     PYAAVNDIQG TLNHKHVLAR DMVTEVEHPA CGPIKLVNTP IKYSEATPGV RTPPPTLGQH       420
     TDEILGSVLD YGEADIARLK DEGVVS                                            446
//

If you have problems or comments...

PBIL Back to PBIL home page