(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE279

PENCW_10.PE279       Location/Qualifiers
FT   CDS             643313..644860
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949857"
FT                   /orf_name="Pc13g02790"
FT                   /product="Pc13g02790 protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP91348.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniParc:UPI0001830DD1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1E9"
FT                   /transl_table=1
FT                   /translation="MRVSSAFMDLPATDINPGCPQNVHEGNIFDHEGVSEAIQPLPYHS
FT                   ELIAENIPWATWGSPAPLQEEAVWTTAGAMETGQQNASAALASNRTRSGRRITQPVARE
FT                   AYPVTTKEPTVTTKGPTVKAAAKKRKRLNRQVNIVCTGCYRGHSPSNNLIVLCDSCDAP
FT                   WHQRCHNPNIDNEVIEIPETNWFCIKCKPEQRQAGWRKSGKNAMKVKKVGRPKKPGVFG
FT                   SQIGGNHYTEEERRAYLSSLSHDSLVQLVVKVSNEWPSVPLFPPDMQPVTDFTLSPAIP
FT                   HNHQASKPTPKNNARSAILDWENLESMSQNANAMDSKQRISETSDATTPAATALDADKT
FT                   FAAMVSDSVPEPAPPAALGGIPAGQIFAGSSHTHAYATAPQTSTTTTPQTPSRATRRFT
FT                   SQAAPAARHARTASFVSSYSDLLTDDESSYSQSRQQSPTPSASQSSHAESQHESDYDPG
FT                   DYRAYPEAGQGFQVPLTPSDLDIMAEDKDCLTFSHSIRGPEAQNKKPYSPFGQRKQW"
     MRVSSAFMDL PATDINPGCP QNVHEGNIFD HEGVSEAIQP LPYHSELIAE NIPWATWGSP        60
     APLQEEAVWT TAGAMETGQQ NASAALASNR TRSGRRITQP VAREAYPVTT KEPTVTTKGP       120
     TVKAAAKKRK RLNRQVNIVC TGCYRGHSPS NNLIVLCDSC DAPWHQRCHN PNIDNEVIEI       180
     PETNWFCIKC KPEQRQAGWR KSGKNAMKVK KVGRPKKPGV FGSQIGGNHY TEEERRAYLS       240
     SLSHDSLVQL VVKVSNEWPS VPLFPPDMQP VTDFTLSPAI PHNHQASKPT PKNNARSAIL       300
     DWENLESMSQ NANAMDSKQR ISETSDATTP AATALDADKT FAAMVSDSVP EPAPPAALGG       360
     IPAGQIFAGS SHTHAYATAP QTSTTTTPQT PSRATRRFTS QAAPAARHAR TASFVSSYSD       420
     LLTDDESSYS QSRQQSPTPS ASQSSHAESQ HESDYDPGDY RAYPEAGQGF QVPLTPSDLD       480
     IMAEDKDCLT FSHSIRGPEA QNKKPYSPFG QRKQW                                  515
//

If you have problems or comments...

PBIL Back to PBIL home page