(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE28

PENCW_10.PE28        Location/Qualifiers
FT   CDS             join(complement(68009..68143),complement(67448..67856),
FT                   complement(67232..67398))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948691"
FT                   /orf_name="Pc13g00280"
FT                   /product="Putative uncharacterized protein Pc13g00280 "
FT                   /protein_id="CAP91097.1"
FT                   /db_xref="UniParc:UPI0001830DC3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H176"
FT                   /transl_table=1
FT                   /translation="MDHTDKRKASFYDLSQEILESIAIFTFLITYISVRFAVGHGLCSA
FT                   VENLVQLGASLKHIPCGDMVERAARSHNYKKLLSWLIDHGASFREVQGGIDRLCCEAYE
FT                   QGDFERFRWLFSKGASLDVLAGVVFDFSGCHRPRSREACRYHLLPLKRALREGAKPSGS
FT                   HEALTAELRLRRHKGLGDGEAWHSASKHVILPSDRVVEELCCQASRSSRARIQFYHLAD
FT                   IGKKGPSRRFMINP"
     MDHTDKRKAS FYDLSQEILE SIAIFTFLIT YISVRFAVGH GLCSAVENLV QLGASLKHIP        60
     CGDMVERAAR SHNYKKLLSW LIDHGASFRE VQGGIDRLCC EAYEQGDFER FRWLFSKGAS       120
     LDVLAGVVFD FSGCHRPRSR EACRYHLLPL KRALREGAKP SGSHEALTAE LRLRRHKGLG       180
     DGEAWHSASK HVILPSDRVV EELCCQASRS SRARIQFYHL ADIGKKGPSR RFMINP           236
//

If you have problems or comments...

PBIL Back to PBIL home page