(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE280

PENCW_10.PE280       Location/Qualifiers
FT   CDS             join(complement(646151..646202),complement(645975..646002),
FT                   complement(645724..645755),complement(645487..645639),
FT                   complement(645389..645415),complement(645205..645305),
FT                   complement(645084..645119))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824877"
FT                   /orf_name="Pc13g02800"
FT                   /product="Putative uncharacterized protein Pc13g02800 "
FT                   /protein_id="CAP91349.1"
FT                   /db_xref="UniParc:UPI0001830DD2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1F0"
FT                   /transl_table=1
FT                   /translation="MAFLYFLGTGQAFGQRASVAHRTRATGIPKGFPRAPLGRSKEPSE
FT                   PQGRNRHWTTEAICWRYDSLELKWPVTCRGTGEEGRGGGGRGEVAEGQEGTWVKNXHGD
FT                   YPEYRIGDLVYPFRRLILTSSRQAKGKRRKYEESTQSL"
     MAFLYFLGTG QAFGQRASVA HRTRATGIPK GFPRAPLGRS KEPSEPQGRN RHWTTEAICW        60
     RYDSLELKWP VTCRGTGEEG RGGGGRGEVA EGQEGTWVKN XHGDYPEYRI GDLVYPFRRL       120
     ILTSSRQAKG KRRKYEESTQ SL                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page