(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE281

PENCW_10.PE281       Location/Qualifiers
FT   CDS             join(complement(648448..648881),complement(647618..648386),
FT                   complement(647050..647468),complement(646315..647005))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949858"
FT                   /orf_name="Pc13g02810"
FT                   /product="Pc13g02810 protein"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="CAP91350.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="UniParc:UPI0001830DD3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1G2"
FT                   /transl_table=1
FT                   /translation="MATSTVDEGGPVGIKKELREALDAIVSSGTFASQGRLPHVDPQIK
FT                   VQDVGAISLPLQESQLRQMMKQAHQAPYGKGSETLVDTAVRNTLELNPGQFELSNPNWD
FT                   NYIKRACTCVARDLGVDSPVSAELYKMLIYEKGAMFKPHTDTEKAPGMFATLVIGLPSP
FT                   FEGGEVAVKHQGKKMVLTTLQHGFSYVSWYSDVVHEILAVRSGYRWVLTYNLCIDPSRP
FT                   CPTACLHTDEARHLHRILKTWLNQNTAERELSHAYYRLDHEYTKANISLNALKGRDLAS
FT                   VHLLKEISNDLNMEIFLAVIAKGQMGPCRYEEPYSRKSYRSSRSYFNIYLENHNAGYRG
FT                   RSGAIHALEQIINTSYEVDTLVGLDGCEVMESMPLKNDNVLQMKCFDVDPQEDYMGYQG
FT                   NFAVVIVPRDSIAHFLKVPTERSGPYTESTCQGNKALMIGYLAKSLAHTPDDQFLIKTL
FT                   KDLCQEVWTMSETGPPGSSRPPRVVLPEAVITKVLQAAIISKDPDFVKDAVGRLERNLS
FT                   PDFFTWVQEQTAVGLITFDTIKDILLSGSIVGILSRTICSHAPAMEASDFHSLWLPFLH
FT                   HLVRFCEANSIPTSTPDYQRIFAAILKAYINNYVGERPSHDGNYVRPTVGHGCADCISL
FT                   NRFLSDPAQTVGRFSVNQKRRHHLHLRLDAAKIDCTHETERIGSPQTLVVTKSFPRHER
FT                   DSAAWGKRKAEAGVKLLDFNKRDLTGWFGEEYEGLMGMVGHGPSSGRRPAGPVPNRPTR
FT                   PRKRKAADIDVVDLRDD"
     MATSTVDEGG PVGIKKELRE ALDAIVSSGT FASQGRLPHV DPQIKVQDVG AISLPLQESQ        60
     LRQMMKQAHQ APYGKGSETL VDTAVRNTLE LNPGQFELSN PNWDNYIKRA CTCVARDLGV       120
     DSPVSAELYK MLIYEKGAMF KPHTDTEKAP GMFATLVIGL PSPFEGGEVA VKHQGKKMVL       180
     TTLQHGFSYV SWYSDVVHEI LAVRSGYRWV LTYNLCIDPS RPCPTACLHT DEARHLHRIL       240
     KTWLNQNTAE RELSHAYYRL DHEYTKANIS LNALKGRDLA SVHLLKEISN DLNMEIFLAV       300
     IAKGQMGPCR YEEPYSRKSY RSSRSYFNIY LENHNAGYRG RSGAIHALEQ IINTSYEVDT       360
     LVGLDGCEVM ESMPLKNDNV LQMKCFDVDP QEDYMGYQGN FAVVIVPRDS IAHFLKVPTE       420
     RSGPYTESTC QGNKALMIGY LAKSLAHTPD DQFLIKTLKD LCQEVWTMSE TGPPGSSRPP       480
     RVVLPEAVIT KVLQAAIISK DPDFVKDAVG RLERNLSPDF FTWVQEQTAV GLITFDTIKD       540
     ILLSGSIVGI LSRTICSHAP AMEASDFHSL WLPFLHHLVR FCEANSIPTS TPDYQRIFAA       600
     ILKAYINNYV GERPSHDGNY VRPTVGHGCA DCISLNRFLS DPAQTVGRFS VNQKRRHHLH       660
     LRLDAAKIDC THETERIGSP QTLVVTKSFP RHERDSAAWG KRKAEAGVKL LDFNKRDLTG       720
     WFGEEYEGLM GMVGHGPSSG RRPAGPVPNR PTRPRKRKAA DIDVVDLRDD                  770
//

If you have problems or comments...

PBIL Back to PBIL home page