(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE282

PENCW_10.PE282       Location/Qualifiers
FT   CDS             join(650582..651107,651273..651856)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210061" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672173"
FT                   /orf_name="Pc13g02820"
FT                   /product="Pc13g02820 protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP91351.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001830DD4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1G3"
FT                   /transl_table=1
FT                   /translation="MTSSTPQLLRTTAKPSHPAPGTTNSHTNFLTIDTLISILSKSLLN
FT                   PFVAWIFVLCLRAQVTPSTDPAWILAVSYATVLTVLSIARLINQRAADGVPRTVDFEHE
FT                   VVVITGGASGLGLLIAQMYSMRGASVAVLDIKAVPENSRDEIFGEGVLYITCDVADRGA
FT                   LEVAKERILQEVGTPTIVINCAAARINGLSLLDLPADAFEKTIRTNLLAAFHLYQVFLP
FT                   GIIAAESGGTLATVSSVLGQLSAAGLSDYAASKAGLSALHRTIEAEIRGNPLIKTLLVE
FT                   VGQMSTPLFDWVRAPNNFFAPVLEPVEVAREMVAAIDSGRGGVIRLPIYAKLVNWYAVL
FT                   PATVQRVARYLSGIDAAVNQSRETSGKTD"
     MTSSTPQLLR TTAKPSHPAP GTTNSHTNFL TIDTLISILS KSLLNPFVAW IFVLCLRAQV        60
     TPSTDPAWIL AVSYATVLTV LSIARLINQR AADGVPRTVD FEHEVVVITG GASGLGLLIA       120
     QMYSMRGASV AVLDIKAVPE NSRDEIFGEG VLYITCDVAD RGALEVAKER ILQEVGTPTI       180
     VINCAAARIN GLSLLDLPAD AFEKTIRTNL LAAFHLYQVF LPGIIAAESG GTLATVSSVL       240
     GQLSAAGLSD YAASKAGLSA LHRTIEAEIR GNPLIKTLLV EVGQMSTPLF DWVRAPNNFF       300
     APVLEPVEVA REMVAAIDSG RGGVIRLPIY AKLVNWYAVL PATVQRVARY LSGIDAAVNQ       360
     SRETSGKTD                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page