(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE284

PENCW_10.PE284       Location/Qualifiers
FT   CDS             join(653681..653942,653997..655003)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210093" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824878"
FT                   /orf_name="Pc13g02840"
FT                   /product="Pc13g02840 protein"
FT                   /protein_id="CAP91353.1"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013143"
FT                   /db_xref="UniParc:UPI0001830DD6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1F2"
FT                   /transl_table=1
FT                   /translation="MSFKVSPRIQEVRGLAKEDPSKAATSYQKILSEGPGSTEASSRDY
FT                   EHALIGLGEVYRDAKKPQEIADLIKTSRDTFSSFAKAKTAKLVRQLLDLISEIPNTLEL
FT                   QGNVIQSCIEWAIAERRSFLRQALQARLVAIYMQKQSYYDALTLINSLLSELKRLDDKL
FT                   MLVEVQLLESRVYHALGNQAKARAALTAARTSAASVYTPPNLQAGLDMQSGMLHAEDKD
FT                   FTTSYSYFIEALEGYSSLDESDLATATLQYMLLCKIMLNLVDDVTQLQGSKQAQKYASP
FT                   RLEAMKAVARAHANRSLEEYEKALSTYRYELGSDVFIRNHLRRLYDAMLEQNLIKVIEP
FT                   FSRVELDHIAKMVGLDTQQVERKLSQMILDKVIIGVLDQGSGCLIVYDETERDQAYDAA
FT                   LETIEKLGNVVEGLYTNQASLLE"
     MSFKVSPRIQ EVRGLAKEDP SKAATSYQKI LSEGPGSTEA SSRDYEHALI GLGEVYRDAK        60
     KPQEIADLIK TSRDTFSSFA KAKTAKLVRQ LLDLISEIPN TLELQGNVIQ SCIEWAIAER       120
     RSFLRQALQA RLVAIYMQKQ SYYDALTLIN SLLSELKRLD DKLMLVEVQL LESRVYHALG       180
     NQAKARAALT AARTSAASVY TPPNLQAGLD MQSGMLHAED KDFTTSYSYF IEALEGYSSL       240
     DESDLATATL QYMLLCKIML NLVDDVTQLQ GSKQAQKYAS PRLEAMKAVA RAHANRSLEE       300
     YEKALSTYRY ELGSDVFIRN HLRRLYDAML EQNLIKVIEP FSRVELDHIA KMVGLDTQQV       360
     ERKLSQMILD KVIIGVLDQG SGCLIVYDET ERDQAYDAAL ETIEKLGNVV EGLYTNQASL       420
     LE                                                                      422
//

If you have problems or comments...

PBIL Back to PBIL home page