(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE285

PENCW_10.PE285       Location/Qualifiers
FT   CDS             join(655342..655432,655494..656362,656415..656939)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210094" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949860"
FT                   /orf_name="Pc13g02850"
FT                   /product="Pc13g02850 protein"
FT                   /protein_id="CAP91354.1"
FT                   /db_xref="InterPro:IPR003121"
FT                   /db_xref="UniParc:UPI0001830DD7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1F3"
FT                   /transl_table=1
FT                   /translation="MQAPMQQHYARAMPPNAQRSPAAPRRPPGPGGAMPVPMPQHAVAQ
FT                   QYMASRPMPHPNDAALRRSRKPTDKNLPDGIEEVIIGEGVQQYKNLRDLEKRLDAAVVR
FT                   KRLDIQDSINKTVKKYRTMRIWISNTVENQPWQGPGNNPGSGRYKVRIEGRLLDDETDP
FT                   TVPDKDEKDEDAMDHDGAQDDKAKKSESKSQSQRFSHFFKAINIDFDKPVSAIPDEVKP
FT                   VNWSKPNAHPNTPAPPNAEFDSLQFSRASQDNLNVTISLVRDEVPERYKLSKELAEVLD
FT                   VEEETRSGIVLGIWDYIRAMELQEDEEKRQVRCDHRLRSIFGREQMFFPQIPESVGPHT
FT                   SPMEPIKLPYTIRVDEDFHANPTPTIYDIQVAVEDPLRTKMMALTQNPAYTSGLRQISS
FT                   LDDQVALIVQALTHSRARHSFYTALSKDPANFVRRWISSQRRDLETIMGEATRGGGEDG
FT                   SGPEFRYGSVDGPWDSEVAKEAVRYMLAKPEAAAAR"
     MQAPMQQHYA RAMPPNAQRS PAAPRRPPGP GGAMPVPMPQ HAVAQQYMAS RPMPHPNDAA        60
     LRRSRKPTDK NLPDGIEEVI IGEGVQQYKN LRDLEKRLDA AVVRKRLDIQ DSINKTVKKY       120
     RTMRIWISNT VENQPWQGPG NNPGSGRYKV RIEGRLLDDE TDPTVPDKDE KDEDAMDHDG       180
     AQDDKAKKSE SKSQSQRFSH FFKAINIDFD KPVSAIPDEV KPVNWSKPNA HPNTPAPPNA       240
     EFDSLQFSRA SQDNLNVTIS LVRDEVPERY KLSKELAEVL DVEEETRSGI VLGIWDYIRA       300
     MELQEDEEKR QVRCDHRLRS IFGREQMFFP QIPESVGPHT SPMEPIKLPY TIRVDEDFHA       360
     NPTPTIYDIQ VAVEDPLRTK MMALTQNPAY TSGLRQISSL DDQVALIVQA LTHSRARHSF       420
     YTALSKDPAN FVRRWISSQR RDLETIMGEA TRGGGEDGSG PEFRYGSVDG PWDSEVAKEA       480
     VRYMLAKPEA AAAR                                                         494
//

If you have problems or comments...

PBIL Back to PBIL home page