(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE286

PENCW_10.PE286       Location/Qualifiers
FT   CDS             join(complement(658207..658690),complement(657372..658111))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210105" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672174"
FT                   /orf_name="Pc13g02860"
FT                   /product="Pc13g02860 protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP91355.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR006634"
FT                   /db_xref="UniParc:UPI0001830DD8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1F4"
FT                   /transl_table=1
FT                   /translation="MLDPFPPPPEWLRSLAEPYAIRLNSPTLADHIHEVIAAFAFYLFI
FT                   HAVLSPRLSPILFARSYNKLTPRTKLNWDIHVVSLVQSVVINAAALWVMYYDEERSSMT
FT                   SGERVFGYTGACGLIQALAVGYFVYDLIVSIVHVRMFGIGMLFHAVSALWVFSLGFVIS
FT                   QRPFLNYFAPTFILYELSSPFLNIHWFLDKVNMTGSRAQWYNGMALLFSFFSCRLVWGT
FT                   WQTVVVYGDMWNALQQTWSAAAAPLSEPASVNANVFYPARDGSLCVNEACARANAEITK
FT                   FKEYTAGGVPTWLVVTYVGSNLILNFLNFFWFSKMVETVLKRFRAPAAAAEKKPGRAEK
FT                   AAQLKEDIVHDVVLEAASKLEQEETAILQGDLSSLQEQVSSGVDSGLGEELRKRKAELV
FT                   AKISLPGV"
     MLDPFPPPPE WLRSLAEPYA IRLNSPTLAD HIHEVIAAFA FYLFIHAVLS PRLSPILFAR        60
     SYNKLTPRTK LNWDIHVVSL VQSVVINAAA LWVMYYDEER SSMTSGERVF GYTGACGLIQ       120
     ALAVGYFVYD LIVSIVHVRM FGIGMLFHAV SALWVFSLGF VISQRPFLNY FAPTFILYEL       180
     SSPFLNIHWF LDKVNMTGSR AQWYNGMALL FSFFSCRLVW GTWQTVVVYG DMWNALQQTW       240
     SAAAAPLSEP ASVNANVFYP ARDGSLCVNE ACARANAEIT KFKEYTAGGV PTWLVVTYVG       300
     SNLILNFLNF FWFSKMVETV LKRFRAPAAA AEKKPGRAEK AAQLKEDIVH DVVLEAASKL       360
     EQEETAILQG DLSSLQEQVS SGVDSGLGEE LRKRKAELVA KISLPGV                     407
//

If you have problems or comments...

PBIL Back to PBIL home page