(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE291

PENCW_10.PE291       Location/Qualifiers
FT   CDS             join(complement(674374..674628),complement(674072..674170))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949862"
FT                   /orf_name="Pc13g02910"
FT                   /product="Putative uncharacterized protein Pc13g02910 "
FT                   /protein_id="CAP91360.1"
FT                   /db_xref="UniParc:UPI0001830EA4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1F8"
FT                   /transl_table=1
FT                   /translation="MTYASASTPLCESSPSARTLAMPVMYPLIGLSVGPSNRPLYSREY
FT                   VTASGPNVGGKPKALAGLEIVLPRACDGRSDSSQIHPNLGGKPKKALVVARFSDLVVGT
FT                   WKKLDMATGLDLS"
     MTYASASTPL CESSPSARTL AMPVMYPLIG LSVGPSNRPL YSREYVTASG PNVGGKPKAL        60
     AGLEIVLPRA CDGRSDSSQI HPNLGGKPKK ALVVARFSDL VVGTWKKLDM ATGLDLS          117
//

If you have problems or comments...

PBIL Back to PBIL home page