(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE292

PENCW_10.PE292       Location/Qualifiers
FT   CDS             join(675394..675465,675553..676044)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210139" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949863"
FT                   /orf_name="Pc13g02920"
FT                   /product="Pc13g02920 protein"
FT                   /protein_id="CAP91361.1"
FT                   /db_xref="UniParc:UPI0001830EA5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1F9"
FT                   /transl_table=1
FT                   /translation="MPHAEAKMGEPVVNGEKHYSQFFDHLTSYPIISDSISYYKGNPYG
FT                   AKSLEYADQGYTRLAKPVLPYFSTPYSYVAPYIARADSLGDKGLSQIDARFPIFKEDTQ
FT                   KLRGSIYNSASLPVRVVGDVKHHVTDIYGSEYKKCGGDSVFASGKAVITTSLVLSQESL
FT                   AWVNAFLQSKKEEAKEVVNEKNSH"
     MPHAEAKMGE PVVNGEKHYS QFFDHLTSYP IISDSISYYK GNPYGAKSLE YADQGYTRLA        60
     KPVLPYFSTP YSYVAPYIAR ADSLGDKGLS QIDARFPIFK EDTQKLRGSI YNSASLPVRV       120
     VGDVKHHVTD IYGSEYKKCG GDSVFASGKA VITTSLVLSQ ESLAWVNAFL QSKKEEAKEV       180
     VNEKNSH                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page