(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE293

PENCW_10.PE293       Location/Qualifiers
FT   CDS             join(676663..676876,676960..677651)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210150" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949864"
FT                   /orf_name="Pc13g02930"
FT                   /product="Pc13g02930 protein"
FT                   /protein_id="CAP91362.1"
FT                   /db_xref="InterPro:IPR002190"
FT                   /db_xref="UniParc:UPI0001830EA6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1G0"
FT                   /transl_table=1
FT                   /translation="MVKKLVRLAIASEYSRLPIRRNDISAKVLGEQGSRQFKLVFDQAQ
FT                   REMRQRFGMEMTELPAREKVTITQRRAAQKTEKPSSANKSWIVTSTLPLPYRSSDILIP
FT                   TKAPSLYTESTYTGLYSFIIAVIVLNGGSLAEQKLDRYLSRTNAEVATPIDRTDKLLQR
FT                   LCKEGYIIKTREMDGGEEVIEYVLGPRGKIEVGTSGVAGLVRTVYGKEKGDHEGLTHLQ
FT                   REELEDFEGKLGRSLGIEPAPVRANGVDGASDVGDARVNGSAEDCEAPQSSGPRRSSRR
FT                   APTQEEDEEEDDDSEEYEEE"
     MVKKLVRLAI ASEYSRLPIR RNDISAKVLG EQGSRQFKLV FDQAQREMRQ RFGMEMTELP        60
     AREKVTITQR RAAQKTEKPS SANKSWIVTS TLPLPYRSSD ILIPTKAPSL YTESTYTGLY       120
     SFIIAVIVLN GGSLAEQKLD RYLSRTNAEV ATPIDRTDKL LQRLCKEGYI IKTREMDGGE       180
     EVIEYVLGPR GKIEVGTSGV AGLVRTVYGK EKGDHEGLTH LQREELEDFE GKLGRSLGIE       240
     PAPVRANGVD GASDVGDARV NGSAEDCEAP QSSGPRRSSR RAPTQEEDEE EDDDSEEYEE       300
     E                                                                       301
//

If you have problems or comments...

PBIL Back to PBIL home page