(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE294

PENCW_10.PE294       Location/Qualifiers
FT   CDS             join(complement(680142..680146),complement(679806..680074),
FT                   complement(678639..679747))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000229291" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824879"
FT                   /orf_name="Pc13g02940"
FT                   /product="Pc13g02940 protein"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /function="translation elongation factor activity "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP91363.1"
FT                   /db_xref="GO:0003746"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004539"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="UniParc:UPI0001830EA7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1G1"
FT                   /transl_table=1
FT                   /translation="MGKEERSHLNIVVIGHVDSGKSTTTGHMIYKCGGIDQRTIEKFEK
FT                   EAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFQTSKYEVTVIDAPGHRDFIKNMI
FT                   TGTSQADCAILIIASGTGEFEAGISKDGQTREHALLAFTLGVKQLIVALNKMDTCKWSE
FT                   ERYNEIVKETSNFIKKVGYNPKAVPFVPISGFNGDNMLEASTNCPWYKGWEKETKAGKA
FT                   TGKTLLEAIDAIEPPVRPSNKPLRLPLQDVYKISGIGTVPVGRVETGIISPGMVVTFAP
FT                   ANVTTEVKSVEMHHQQLKAGNPGDNVGFNVKNVSVKEVRRGNVASDSKNDPAAGCDSFN
FT                   AQVIVLNHPGQVGAGYAPVLDCHTAHIACKFAELLEKIDRRTGKATETSPKFIKSGDAA
FT                   IVKMVPSKPMCVETFTDYPPLGRFAVRDMRQTVAVGVIKSVVKNAGGAGKVTKAAAKAG
FT                   KK"
     MGKEERSHLN IVVIGHVDSG KSTTTGHMIY KCGGIDQRTI EKFEKEAAEL GKGSFKYAWV        60
     LDKLKAERER GITIDIALWK FQTSKYEVTV IDAPGHRDFI KNMITGTSQA DCAILIIASG       120
     TGEFEAGISK DGQTREHALL AFTLGVKQLI VALNKMDTCK WSEERYNEIV KETSNFIKKV       180
     GYNPKAVPFV PISGFNGDNM LEASTNCPWY KGWEKETKAG KATGKTLLEA IDAIEPPVRP       240
     SNKPLRLPLQ DVYKISGIGT VPVGRVETGI ISPGMVVTFA PANVTTEVKS VEMHHQQLKA       300
     GNPGDNVGFN VKNVSVKEVR RGNVASDSKN DPAAGCDSFN AQVIVLNHPG QVGAGYAPVL       360
     DCHTAHIACK FAELLEKIDR RTGKATETSP KFIKSGDAAI VKMVPSKPMC VETFTDYPPL       420
     GRFAVRDMRQ TVAVGVIKSV VKNAGGAGKV TKAAAKAGKK                             460
//

If you have problems or comments...

PBIL Back to PBIL home page