(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE297

PENCW_10.PE297       Location/Qualifiers
FT   CDS             join(complement(684657..685036),complement(683264..684599))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000209670" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949865"
FT                   /orf_name="Pc13g02970"
FT                   /product="Pc13g02970 protein"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="CAP91366.1"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniParc:UPI0001830EAA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1G6"
FT                   /transl_table=1
FT                   /translation="MALLSNAILATLVLTATAVLLPKLTGVLLGLVFRGVGWLIWRRTR
FT                   SRREYVIARARSEEEELRASRPKGSTLSRNGAEDEDWEKVDSSGTGGVQTTAGSGSSSG
FT                   SGNESYESPEDWDGIIGFFHPFCNAGGGGERVLWEAIRATQKRWPKAICAIYTGDHEVN
FT                   KATMLEKVENRFNIRLHAPTVVLLYLTTRKYVVSSSYPYMTLLGQSLGSLIVAYDAFTL
FT                   LVPDVFVDTMGYAFTLALCKWFFPRIPVGAYVHYPTISTDMLASLDDKSGVQGINSGAG
FT                   RGWKGKTKRRYWEIFAKLYGWVGRQVDVVMCNSSWTAAHIRTLWGTGKKINNSSGDGSP
FT                   SSPAVVFPPTAVTELQSNIVVDTDSEKTRQPVLLYIAQFRPEKNHPLVLRSFARFLQER
FT                   TNNPAYEGQPPPRLVLIGSVRHSSPDETHIYNLRLLAHELRIRDHTTFLCDASWPVMLS
FT                   HLRTASVGVNAMWNEHFGICVVEYQAAGLICVTHDSGGPREDIVVDLGDGATGFRAETE
FT                   EQFAASFEAALALPEAEKLAMRQRARRSAQRFTEEEFSRKWLDQVQKLVKASTV"
     MALLSNAILA TLVLTATAVL LPKLTGVLLG LVFRGVGWLI WRRTRSRREY VIARARSEEE        60
     ELRASRPKGS TLSRNGAEDE DWEKVDSSGT GGVQTTAGSG SSSGSGNESY ESPEDWDGII       120
     GFFHPFCNAG GGGERVLWEA IRATQKRWPK AICAIYTGDH EVNKATMLEK VENRFNIRLH       180
     APTVVLLYLT TRKYVVSSSY PYMTLLGQSL GSLIVAYDAF TLLVPDVFVD TMGYAFTLAL       240
     CKWFFPRIPV GAYVHYPTIS TDMLASLDDK SGVQGINSGA GRGWKGKTKR RYWEIFAKLY       300
     GWVGRQVDVV MCNSSWTAAH IRTLWGTGKK INNSSGDGSP SSPAVVFPPT AVTELQSNIV       360
     VDTDSEKTRQ PVLLYIAQFR PEKNHPLVLR SFARFLQERT NNPAYEGQPP PRLVLIGSVR       420
     HSSPDETHIY NLRLLAHELR IRDHTTFLCD ASWPVMLSHL RTASVGVNAM WNEHFGICVV       480
     EYQAAGLICV THDSGGPRED IVVDLGDGAT GFRAETEEQF AASFEAALAL PEAEKLAMRQ       540
     RARRSAQRFT EEEFSRKWLD QVQKLVKAST V                                      571
//

If you have problems or comments...

PBIL Back to PBIL home page