(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE298

PENCW_10.PE298       Location/Qualifiers
FT   CDS             685294..686331
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000209671" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978072"
FT                   /orf_name="Pc13g02980"
FT                   /product="Pc13g02980 protein"
FT                   /biological_process="protein insertion into membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP91367.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0051205"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="UniParc:UPI0001830EAB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H202"
FT                   /transl_table=1
FT                   /translation="MYALRSSQTIQLTRRAIQLPRSQVRYFHPTRPASFSVVGLALDSS
FT                   TAFIHGVHTVSCLPWVASIPLTAVLIRTFVGLPILLYTRLHRHREMKIVPILSAWMKRY
FT                   AQKQMDQVPTANLRNYNNTEVKRNILTELRKRTAVLHKRWGVSSKYKAIGFLQIPVFIA
FT                   LMESLRGMSGNNSGIIAWLSSFIESSQDPASTAQPLHLTIEPTLANEGALWFPDLLAGD
FT                   PTGVLPLCLTASILGNVLMGWKVKPWKEIALLPKIEMYKQTLFTGLRSFVIVLTCYIGF
FT                   ASFVQGMPTALMLYWITSTNVATLQTWVLDKKVFSPPGFKRFVEKSIAFEKPGVEDPFQ
FT                   LKNLR"
     MYALRSSQTI QLTRRAIQLP RSQVRYFHPT RPASFSVVGL ALDSSTAFIH GVHTVSCLPW        60
     VASIPLTAVL IRTFVGLPIL LYTRLHRHRE MKIVPILSAW MKRYAQKQMD QVPTANLRNY       120
     NNTEVKRNIL TELRKRTAVL HKRWGVSSKY KAIGFLQIPV FIALMESLRG MSGNNSGIIA       180
     WLSSFIESSQ DPASTAQPLH LTIEPTLANE GALWFPDLLA GDPTGVLPLC LTASILGNVL       240
     MGWKVKPWKE IALLPKIEMY KQTLFTGLRS FVIVLTCYIG FASFVQGMPT ALMLYWITST       300
     NVATLQTWVL DKKVFSPPGF KRFVEKSIAF EKPGVEDPFQ LKNLR                       345
//

If you have problems or comments...

PBIL Back to PBIL home page