(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE299

PENCW_10.PE299       Location/Qualifiers
FT   CDS             join(complement(688430..689094),complement(687357..688376),
FT                   complement(687188..687299))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209682" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949866"
FT                   /orf_name="Pc13g02990"
FT                   /product="Pc13g02990 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP91368.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014045"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="UniParc:UPI0001830EAC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H203"
FT                   /transl_table=1
FT                   /translation="MRQATVQACRTARRAPVWNIAAKRPCPLTFNQLRGIRPYSGGRRS
FT                   SHTPVAPRSSMHRRNLSLAVISTVVASGAWYTCQGDTVKSAATQIRSFASSALNSAYAE
FT                   GPAESTRRALLVSGDQFYTATLSADQPLTKHTDDSDRRVLEMLTPEQATQKLRKNEESY
FT                   LVNRGKGVVRYDVVQVPSNSPIEDDHAEKIVEIPASVSAVSDGEPSSDWMFWGVFDGHS
FT                   GWTTSAKLRNVLISYVARELNTTYKAASADPSLLMPTSEAIDAAIKKGFVRLDNDIVHE
FT                   SFKEVMKSKSRRVAAELLAPALSGSCALLSFYDSQTKDLKVAVTGDSRAVLGRRSPSGK
FT                   WTATALSEDQTGGTPSEMKRLREEHPGEPYVTKNGRILGQLEPSRAFGDAFYKWSRDVQ
FT                   DTIKAKFFGRTPHPMLKTPPYVTAEPIITTTKIDPSKGDFVVMATDGLWEMLSNEEVVG
FT                   LVGHWVEQQQSAAASTGSKAWLQSWFGFDNQKKLPVETAADGSTEGQRRPIRQQQYDIS
FT                   GAASRFVVEDKNAATHLVRNAMGGKDKDMVCALLTLPSPYSRRYRDDVTVEVIFFGQGP
FT                   DSRTVEVNQEASASEQPPKSKL"
     MRQATVQACR TARRAPVWNI AAKRPCPLTF NQLRGIRPYS GGRRSSHTPV APRSSMHRRN        60
     LSLAVISTVV ASGAWYTCQG DTVKSAATQI RSFASSALNS AYAEGPAEST RRALLVSGDQ       120
     FYTATLSADQ PLTKHTDDSD RRVLEMLTPE QATQKLRKNE ESYLVNRGKG VVRYDVVQVP       180
     SNSPIEDDHA EKIVEIPASV SAVSDGEPSS DWMFWGVFDG HSGWTTSAKL RNVLISYVAR       240
     ELNTTYKAAS ADPSLLMPTS EAIDAAIKKG FVRLDNDIVH ESFKEVMKSK SRRVAAELLA       300
     PALSGSCALL SFYDSQTKDL KVAVTGDSRA VLGRRSPSGK WTATALSEDQ TGGTPSEMKR       360
     LREEHPGEPY VTKNGRILGQ LEPSRAFGDA FYKWSRDVQD TIKAKFFGRT PHPMLKTPPY       420
     VTAEPIITTT KIDPSKGDFV VMATDGLWEM LSNEEVVGLV GHWVEQQQSA AASTGSKAWL       480
     QSWFGFDNQK KLPVETAADG STEGQRRPIR QQQYDISGAA SRFVVEDKNA ATHLVRNAMG       540
     GKDKDMVCAL LTLPSPYSRR YRDDVTVEVI FFGQGPDSRT VEVNQEASAS EQPPKSKL         598
//

If you have problems or comments...

PBIL Back to PBIL home page