(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE30

PENCW_10.PE30        Location/Qualifiers
FT   CDS             join(69321..69528,69596..69822)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178297" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977820"
FT                   /orf_name="Pc13g00300"
FT                   /product="Pc13g00300 protein"
FT                   /function="RNA binding"
FT                   /function="ribonuclease III activity"
FT                   /biological_process="RNA processing"
FT                   /protein_id="CAP91099.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004525"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="UniParc:UPI0001830DC4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H177"
FT                   /transl_table=1
FT                   /translation="MSTYLSAESIRAIESILNYEFHDKSLLDKAFEAPGATEARGGHQR
FT                   QALIGDAALKLVLTELGYEGNASTGEITISRGSRVSNENLKRLGESLGLNAYFRLNPAS
FT                   QGVVPRSMMATTMEAIIGAVYLDSGKDMATTRALVNRLGI"
     MSTYLSAESI RAIESILNYE FHDKSLLDKA FEAPGATEAR GGHQRQALIG DAALKLVLTE        60
     LGYEGNASTG EITISRGSRV SNENLKRLGE SLGLNAYFRL NPASQGVVPR SMMATTMEAI       120
     IGAVYLDSGK DMATTRALVN RLGI                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page