(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE300

PENCW_10.PE300       Location/Qualifiers
FT   CDS             join(689376..689872,689984..691544)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209693" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672176"
FT                   /orf_name="Pc13g03000"
FT                   /product="Pc13g03000 protein"
FT                   /protein_id="CAP91369.1"
FT                   /db_xref="InterPro:IPR006994"
FT                   /db_xref="UniParc:UPI0001830EAD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H204"
FT                   /transl_table=1
FT                   /translation="MSSRAIRKLQKLREQAQQRESDQQDESSEDEAPRPAKPKFNAFDL
FT                   LNAENEDEEEDEDEAQEEPYARIPEPEPEPTPVKPKKSNKKKKKKAVKTSDPASTPPSK
FT                   SNEADLDEIDRALKDLSTGGPTSVGTGLSTRHPPEASFPKTTSELLGIEPKFLNATNEM
FT                   RRLYSPASRGQSLAGVTLRRNILMQGKDEWPRAPSGGLGMETVKKLPSGETLYRLVHNT
FT                   AYQDVQRQFDLCVESMDPQRLIGHLQYNPYHISTLLQVSEIAKHQGDHAVSADLMERAL
FT                   FNIGRSVHSSFANRLKEGEARLDFIHAENREFWLVGWRYITNLAMKGTWRTAYEWAKLL
FT                   LSLDDSDPYCMRLLIDHLALRGREYAQFVQLCTQTRFSRDWANLPNIQCSLVMAYLRLN
FT                   KPQECRRQLQLAMSHYPWIFSRLAQELDVQHVPKQIWGKMPPTGAHELLTELYIARAKD
FT                   LWNTPEAISLIMEVADSISGEEPNEPPEITLDIARHVVLSDIAKVTTHLPNHFVAGRLS
FT                   SSDPLPPYESEAYQQQSEPTPIYAAPAGGGENWLQDLLGQINHNVRPRNVESDDGEPIG
FT                   FEDEDEDEDTEHIDIPHSRPPLRDPAALEGWLTREGLQTLRIFLTQYGVDRGNWSEVVV
FT                   DYAPLTNYLEAMAAISETARQRLLDGSIKDSLGDFAVSMLEDELAIMRGE"
     MSSRAIRKLQ KLREQAQQRE SDQQDESSED EAPRPAKPKF NAFDLLNAEN EDEEEDEDEA        60
     QEEPYARIPE PEPEPTPVKP KKSNKKKKKK AVKTSDPAST PPSKSNEADL DEIDRALKDL       120
     STGGPTSVGT GLSTRHPPEA SFPKTTSELL GIEPKFLNAT NEMRRLYSPA SRGQSLAGVT       180
     LRRNILMQGK DEWPRAPSGG LGMETVKKLP SGETLYRLVH NTAYQDVQRQ FDLCVESMDP       240
     QRLIGHLQYN PYHISTLLQV SEIAKHQGDH AVSADLMERA LFNIGRSVHS SFANRLKEGE       300
     ARLDFIHAEN REFWLVGWRY ITNLAMKGTW RTAYEWAKLL LSLDDSDPYC MRLLIDHLAL       360
     RGREYAQFVQ LCTQTRFSRD WANLPNIQCS LVMAYLRLNK PQECRRQLQL AMSHYPWIFS       420
     RLAQELDVQH VPKQIWGKMP PTGAHELLTE LYIARAKDLW NTPEAISLIM EVADSISGEE       480
     PNEPPEITLD IARHVVLSDI AKVTTHLPNH FVAGRLSSSD PLPPYESEAY QQQSEPTPIY       540
     AAPAGGGENW LQDLLGQINH NVRPRNVESD DGEPIGFEDE DEDEDTEHID IPHSRPPLRD       600
     PAALEGWLTR EGLQTLRIFL TQYGVDRGNW SEVVVDYAPL TNYLEAMAAI SETARQRLLD       660
     GSIKDSLGDF AVSMLEDELA IMRGE                                             685
//

If you have problems or comments...

PBIL Back to PBIL home page