(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE301

PENCW_10.PE301       Location/Qualifiers
FT   CDS             complement(691936..692937)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217090" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129243"
FT                   /orf_name="Pc13g03010"
FT                   /product="Pc13g03010 protein"
FT                   /protein_id="CAP91370.1"
FT                   /db_xref="UniParc:UPI0001830F6E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H205"
FT                   /transl_table=1
FT                   /translation="MTQNNATSTTNIKTRFLICSDTHGLDSLPGFIPSAEQHADVAIHC
FT                   GDLTTQSQLHEYKASIRLLQAIDAPLKLVIAGNHDFTMDIPMFHKKVADAQSLERELVE
FT                   QAYGYDGEARRLFEGTGITFLDEGVHSFHLQNGALLTVYASPYTPSLGDWGFQYHPDKG
FT                   HDFMIDNGSGTNTVDVVMTHGPPKGIMDYTHSGERAGSPDLFRALARARPRMHCFGHIH
FT                   EGWGAKLVTWRDRTTAMPSHLTDIDNGQSYPIAKLSDMKDRAEQSLSGDSAPMKYFATS
FT                   HCSEDAHPLNWGSQTLFVNAAIKGTPQGIYKQKENLSMQLPWAVDLELRSSA"
     MTQNNATSTT NIKTRFLICS DTHGLDSLPG FIPSAEQHAD VAIHCGDLTT QSQLHEYKAS        60
     IRLLQAIDAP LKLVIAGNHD FTMDIPMFHK KVADAQSLER ELVEQAYGYD GEARRLFEGT       120
     GITFLDEGVH SFHLQNGALL TVYASPYTPS LGDWGFQYHP DKGHDFMIDN GSGTNTVDVV       180
     MTHGPPKGIM DYTHSGERAG SPDLFRALAR ARPRMHCFGH IHEGWGAKLV TWRDRTTAMP       240
     SHLTDIDNGQ SYPIAKLSDM KDRAEQSLSG DSAPMKYFAT SHCSEDAHPL NWGSQTLFVN       300
     AAIKGTPQGI YKQKENLSMQ LPWAVDLELR SSA                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page