(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE302

PENCW_10.PE302       Location/Qualifiers
FT   CDS             join(693212..693575,693660..693940,693994..694164,
FT                   694221..694535)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000180601" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949867"
FT                   /orf_name="Pc13g03020"
FT                   /product="Pc13g03020 protein"
FT                   /protein_id="CAP91371.1"
FT                   /db_xref="UniParc:UPI0001830F6F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H206"
FT                   /transl_table=1
FT                   /translation="MASKRPRSDSPEASFSRPRRKVTEPDPPPPVPYEDSIFSVQTDVS
FT                   EFTRAANLTAMLDRIDRYTTSAERPHDEILQASLRNFLEMLPPDGCAELLKDIDSKPGD
FT                   EGLYEVFSNLYTGLRCRMMSRSKPPSITPFPNPKRGDNAEALSAKMDKPISRDRKFKTA
FT                   LLARDGYKCAVTGHFDQGRYEELGLDSPDLNPTDTQGAHIIPFSYGFWNSSQSPPPDMA
FT                   TAWEVLYRCFPALRRLRFNWEDINNLENGITMAEWIHSRFGKFRLAFEATEVPDQYDVE
FT                   IFGPIGNAYRNMIHDRITFTNHDSAKDHKLPSSILLECHYILAKILNASGMAEAFDHDF
FT                   DRWEAVKESVHSLREDGKTDIGSILGLSFLCDDIAR"
     MASKRPRSDS PEASFSRPRR KVTEPDPPPP VPYEDSIFSV QTDVSEFTRA ANLTAMLDRI        60
     DRYTTSAERP HDEILQASLR NFLEMLPPDG CAELLKDIDS KPGDEGLYEV FSNLYTGLRC       120
     RMMSRSKPPS ITPFPNPKRG DNAEALSAKM DKPISRDRKF KTALLARDGY KCAVTGHFDQ       180
     GRYEELGLDS PDLNPTDTQG AHIIPFSYGF WNSSQSPPPD MATAWEVLYR CFPALRRLRF       240
     NWEDINNLEN GITMAEWIHS RFGKFRLAFE ATEVPDQYDV EIFGPIGNAY RNMIHDRITF       300
     TNHDSAKDHK LPSSILLECH YILAKILNAS GMAEAFDHDF DRWEAVKESV HSLREDGKTD       360
     IGSILGLSFL CDDIAR                                                       376
//

If you have problems or comments...

PBIL Back to PBIL home page