(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE303

PENCW_10.PE303       Location/Qualifiers
FT   CDS             join(695704..695790,695843..696441,696494..696543,
FT                   696595..696653,696712..696861)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000159593" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949868"
FT                   /orf_name="Pc13g03030"
FT                   /product="Pc13g03030 protein"
FT                   /protein_id="CAP91372.1"
FT                   /db_xref="InterPro:IPR006603"
FT                   /db_xref="UniParc:UPI0001830F70"
FT                   /db_xref="UniProtKB/TrEMBL:B6H207"
FT                   /transl_table=1
FT                   /translation="MEGPIPLTAREAASGLLGSVSMTCWFFLLVPQLIENYRNGNAEAI
FT                   SLLFVFVWFIGDVANLAGGLLSRLVPVIIAIAVYFCIADGVLIAQCVYYKVRNSRPEPF
FT                   HRRRSSTETPDPTTPLLGRRFSDSLASSQSRRRSSGSLRRYHAGRRESEVEGTLAKIVE
FT                   ENDYGRKAWVKNFASVVGIFLIGMAGWTIAWQTGMWVPAPLENNNGSEEATGGLVLGYF
FT                   SAACYLGARLPQIYKNYSEKSCEGLSLLFFILSLLGNLTYGAGILCHSTEKEYFLTNLP
FT                   WLIGSLGTMVEDAVIFFQFRIYAIQEPRLSAIS"
     MEGPIPLTAR EAASGLLGSV SMTCWFFLLV PQLIENYRNG NAEAISLLFV FVWFIGDVAN        60
     LAGGLLSRLV PVIIAIAVYF CIADGVLIAQ CVYYKVRNSR PEPFHRRRSS TETPDPTTPL       120
     LGRRFSDSLA SSQSRRRSSG SLRRYHAGRR ESEVEGTLAK IVEENDYGRK AWVKNFASVV       180
     GIFLIGMAGW TIAWQTGMWV PAPLENNNGS EEATGGLVLG YFSAACYLGA RLPQIYKNYS       240
     EKSCEGLSLL FFILSLLGNL TYGAGILCHS TEKEYFLTNL PWLIGSLGTM VEDAVIFFQF       300
     RIYAIQEPRL SAIS                                                         314
//

If you have problems or comments...

PBIL Back to PBIL home page