(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE304

PENCW_10.PE304       Location/Qualifiers
FT   CDS             join(complement(697595..697641),complement(697470..697544),
FT                   complement(697184..697319),complement(697084..697158))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949869"
FT                   /orf_name="Pc13g03040"
FT                   /product="Putative uncharacterized protein Pc13g03040 "
FT                   /protein_id="CAP91373.1"
FT                   /db_xref="UniParc:UPI0001830F71"
FT                   /db_xref="UniProtKB/TrEMBL:B6H208"
FT                   /transl_table=1
FT                   /translation="METGCSVYLRVITWPRILGELKTFGTLLGLSMIKVLLWPGDAVGL
FT                   VVGGSLIRCFRSQGDLSLSAPGPYGYRSVDWSSRGLINGAKNCTDNISDVYCCSFQGYA
FT                   VATPLL"
     METGCSVYLR VITWPRILGE LKTFGTLLGL SMIKVLLWPG DAVGLVVGGS LIRCFRSQGD        60
     LSLSAPGPYG YRSVDWSSRG LINGAKNCTD NISDVYCCSF QGYAVATPLL                  110
//

If you have problems or comments...

PBIL Back to PBIL home page