(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE305

PENCW_10.PE305       Location/Qualifiers
FT   CDS             join(complement(698432..698500),complement(698177..698254),
FT                   complement(697943..698072),complement(697839..697885))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000229898" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949870"
FT                   /orf_name="Pc13g03050"
FT                   /product="Pc13g03050 protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translational elongation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAP91374.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006414"
FT                   /db_xref="InterPro:IPR001813"
FT                   /db_xref="UniParc:UPI0001830F72"
FT                   /db_xref="UniProtKB/TrEMBL:B6H209"
FT                   /transl_table=1
FT                   /translation="MSTAELACSYAALILADDGIEVSADKIQTLISAAKVQEVEPIWSS
FT                   IFARALEGKDIKELLTNVGSAGPAAAAPAGGAAAEAPAEAKAEEKVEEKEESDEDMGFG
FT                   LFD"
     MSTAELACSY AALILADDGI EVSADKIQTL ISAAKVQEVE PIWSSIFARA LEGKDIKELL        60
     TNVGSAGPAA AAPAGGAAAE APAEAKAEEK VEEKEESDED MGFGLFD                     107
//

If you have problems or comments...

PBIL Back to PBIL home page