(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE306

PENCW_10.PE306       Location/Qualifiers
FT   CDS             join(698964..699183,699236..699317,699372..699396,
FT                   699467..699745,699808..699974,700028..700241,
FT                   700295..700480,700528..700683)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209704" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129244"
FT                   /orf_name="Pc13g03060"
FT                   /product="Pc13g03060 protein"
FT                   /protein_id="CAP91375.1"
FT                   /db_xref="InterPro:IPR018810"
FT                   /db_xref="UniParc:UPI0001830F73"
FT                   /db_xref="UniProtKB/TrEMBL:B6H210"
FT                   /transl_table=1
FT                   /translation="MESPAIPVPLDPREQPILENLLRTRDALLLIKRDKSSYVKSRDVL
FT                   PLYEEVIAEVEKLNSVRKEQDRRLVHNRLDYVLDDCFQLISLLFLTVGKNNEAPAVYSL
FT                   ATTIQRLLDHLEEAGFYSSKDLNSVTKTLESTRETLERGRNTYSPALLTLLESRLQQCE
FT                   QSLAKLQKGLAVLAPPLAQTHETLVSILRSTSAVNTRSKFSASEVNALREQLKKIEKTT
FT                   KDGNFVDEEGNILAGQDDLKSLMHRCWRWTEIVLEREGKIDERFQDQYDRLLEIRNQLD
FT                   RLSVTQAWSLRETDLFVYQRKLDRIDEARVNGNFVDAEGQPADLHAQRTLLYLIRRSYA
FT                   YIYALLISSEPVSEALLPVYNQLQTLRRCLIEVKESGGVANSRELYPYSMKLNSIDNMR
FT                   VDGKFYVGPDIPEGQGSVNNLLAECYDLVWELRAAVVDEDGES"
     MESPAIPVPL DPREQPILEN LLRTRDALLL IKRDKSSYVK SRDVLPLYEE VIAEVEKLNS        60
     VRKEQDRRLV HNRLDYVLDD CFQLISLLFL TVGKNNEAPA VYSLATTIQR LLDHLEEAGF       120
     YSSKDLNSVT KTLESTRETL ERGRNTYSPA LLTLLESRLQ QCEQSLAKLQ KGLAVLAPPL       180
     AQTHETLVSI LRSTSAVNTR SKFSASEVNA LREQLKKIEK TTKDGNFVDE EGNILAGQDD       240
     LKSLMHRCWR WTEIVLEREG KIDERFQDQY DRLLEIRNQL DRLSVTQAWS LRETDLFVYQ       300
     RKLDRIDEAR VNGNFVDAEG QPADLHAQRT LLYLIRRSYA YIYALLISSE PVSEALLPVY       360
     NQLQTLRRCL IEVKESGGVA NSRELYPYSM KLNSIDNMRV DGKFYVGPDI PEGQGSVNNL       420
     LAECYDLVWE LRAAVVDEDG ES                                                442
//

If you have problems or comments...

PBIL Back to PBIL home page