(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE308

PENCW_10.PE308       Location/Qualifiers
FT   CDS             complement(702486..703322)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076580" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949872"
FT                   /orf_name="Pc13g03080"
FT                   /product="Putative uncharacterized protein Pc13g03080 "
FT                   /protein_id="CAP91377.1"
FT                   /db_xref="UniParc:UPI0001830F75"
FT                   /db_xref="UniProtKB/TrEMBL:B6H212"
FT                   /transl_table=1
FT                   /translation="MQPSERLPSYEETTKVSKALVNEFISGLEAEQSRNSFLIVLLNRR
FT                   LGIDDKCKAIEDAHRIPAIEQDTDAESVEDWLRLRGMHKLAQSVCYYVHTRHSSSNRRW
FT                   CKALIEADIEIRWIVQRMIWVHQQKRNMGPQALDGYLKSLKQKYWRVHRKLWIAEDSIS
FT                   SRSAARAFAFQRQKIDWYLSSELREDCARGGGCCGRACGCCEIPRTIDELRTEGIRNRG
FT                   HCTSACSCCLDAHELDGKNIGDETTDLQGLRFDTTFTEWLPDPHTLRLLKGYVFSI"
     MQPSERLPSY EETTKVSKAL VNEFISGLEA EQSRNSFLIV LLNRRLGIDD KCKAIEDAHR        60
     IPAIEQDTDA ESVEDWLRLR GMHKLAQSVC YYVHTRHSSS NRRWCKALIE ADIEIRWIVQ       120
     RMIWVHQQKR NMGPQALDGY LKSLKQKYWR VHRKLWIAED SISSRSAARA FAFQRQKIDW       180
     YLSSELREDC ARGGGCCGRA CGCCEIPRTI DELRTEGIRN RGHCTSACSC CLDAHELDGK       240
     NIGDETTDLQ GLRFDTTFTE WLPDPHTLRL LKGYVFSI                               278
//

If you have problems or comments...

PBIL Back to PBIL home page