(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE309

PENCW_10.PE309       Location/Qualifiers
FT   CDS             complement(704067..704969)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076580" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978073"
FT                   /orf_name="Pc13g03090"
FT                   /product="Pc13g03090 protein"
FT                   /protein_id="CAP91378.1"
FT                   /db_xref="UniParc:UPI0001830F76"
FT                   /db_xref="UniProtKB/TrEMBL:B6H213"
FT                   /transl_table=1
FT                   /translation="MQASEKLPTYEESTKSPKEILMDRLKKKIEKAQKPEDLLTHLLST
FT                   DLNVEDKATLLRQAPKRIYACYHRRSAEYVEAQLREAGYGGLALYLYWCFFWYEAQPTV
FT                   PESWIKELIELDIEERWVAQRKVCIQEKLQTLQASSERPLSFEDGAKHASQLESYEEQL
FT                   KDLNKRHWALSRKKWNNRTSITSWSFSRAYDIQRSYPQWYLSFDLISDCVGRGGCCGRS
FT                   CGCCKNSRTVGGLDDGINTRGHCTTACGCCLKAHGIEDLDVGINEEIPDLRELCFEYRS
FT                   PPLMSSHSRQLLRGYAFNI"
     MQASEKLPTY EESTKSPKEI LMDRLKKKIE KAQKPEDLLT HLLSTDLNVE DKATLLRQAP        60
     KRIYACYHRR SAEYVEAQLR EAGYGGLALY LYWCFFWYEA QPTVPESWIK ELIELDIEER       120
     WVAQRKVCIQ EKLQTLQASS ERPLSFEDGA KHASQLESYE EQLKDLNKRH WALSRKKWNN       180
     RTSITSWSFS RAYDIQRSYP QWYLSFDLIS DCVGRGGCCG RSCGCCKNSR TVGGLDDGIN       240
     TRGHCTTACG CCLKAHGIED LDVGINEEIP DLRELCFEYR SPPLMSSHSR QLLRGYAFNI       300
//

If you have problems or comments...

PBIL Back to PBIL home page