(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE310

PENCW_10.PE310       Location/Qualifiers
FT   CDS             join(complement(706469..706893),complement(706267..706404),
FT                   complement(706028..706201),complement(705872..705897),
FT                   complement(705651..705760))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129245"
FT                   /orf_name="Pc13g03100"
FT                   /product="Pc13g03100 protein"
FT                   /function="RNA binding"
FT                   /function="RNA-directed DNA polymerase activity "
FT                   /biological_process="RNA-dependent DNA replication "
FT                   /protein_id="CAP91379.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003964"
FT                   /db_xref="GO:0006278"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="UniParc:UPI0001830F77"
FT                   /db_xref="UniProtKB/TrEMBL:B6H214"
FT                   /transl_table=1
FT                   /translation="KIKKILPLEYYNLAKVFLKKKLDKLPLYRPSIDXNIVLKAKVXLD
FT                   YYPLYKLSFNKLKAAKXYIIKNLDKGFIILNASLYISLILIVKKPSSRLRFYIDFRKLN
FT                   IITKKDYYLLPLINKVLXQTSKAKYFTKFNIRXSFYRIYLILGAEDLTTFRIXYRSFKY
FT                   KVILFRLINGLAIFXRFINNILXEYIDKYVVTFIDNILIYSKTLKEYHRXVREVLSYLX
FT                   KASLXVTLLKYKFTIIKTKFLRFIVSIDSIAVNLKKSGXSSYRRPYRXXKAYNPFLDSI
FT                   TSIDDLSKDIVXFXSLYIIXFNRTSYINSLPIIKXPLYSXRRSXLLYXYSIIITXYKKX
FT                   EXKLILXIVYXEXYYLSTIKITISSIXXLSIXKLYKLXSXTIKYRIRNSLLLSIYYRNR
FT                   DXSLRVLYNKIVSRFLXTINLXNTLXLSNKXTNNKRDKASSFYNSISXLNTNXERKILL
FT                   XIYYXERSYLISIIVGSX"
     MSRSYHHSTN TNLRDENGFC GLHGYQPCSC AMLYMTPTVY SQHSNHINQS STYHDLIPAP        60
     CFDLNCCQSD RSTQAPIFIG SRNPPDDGYD AKHTSMDNTS NAFTGVSSPQ MQVSTPPSNI       120
     DPALLEGRTV YYEKLAQSHT PEDPQVPLRC YWGGLTCEHG LVFPDIESLM NHVEMSHINP       180
     QLQANEQSGD VGGLKCSWKE CTSAFRAKGS LSRHVRCLHV NPSSFLCPFC GKGCNREDNL       240
     EDHLSKVNGI HDTQVLEQIS RQAPLAYSVQ LRGTITYSDC LPVIYLGARL                  290
//

If you have problems or comments...

PBIL Back to PBIL home page