(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE311

PENCW_10.PE311       Location/Qualifiers
FT   CDS             join(708277..708321,708371..710722)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000224293" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949873"
FT                   /orf_name="Pc13g03110"
FT                   /product="Pc13g03110 protein"
FT                   /function="4 iron, 4 sulfur cluster binding"
FT                   /function="aconitate hydratase activity"
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /protein_id="CAP91380.1"
FT                   /db_xref="GO:0003994"
FT                   /db_xref="GO:0006099"
FT                   /db_xref="GO:0051539"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006248"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR015937"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="UniParc:UPI0001830F78"
FT                   /db_xref="UniProtKB/TrEMBL:B6H215"
FT                   /transl_table=1
FT                   /translation="MVSQLVWQRVSASRGMATRLSSQRLLARGLATEASSSRMPPYPKL
FT                   VRNLEQVRRVLGSDRALTLAEKILYAHLDNAEESLLTGTNNGRDVRGKANLKLKPDRVA
FT                   MQDASAQMALLQFMSCGLPSTAVPASIHCDHMIVGERGADTDLPASIKGNSEVFDFLES
FT                   AAKRYGIEFWPPGAGIIHQSVLENYAAPGLMMLGTDSHTPNGGGLGAIAIGVGGADAVD
FT                   ALVDAPWELKAPKILGVRLEGKLSGWASPKDIILSLAGKLTVRGGTGSIIEYHGPGVET
FT                   LSCTGMATCCNMGAEVGATTSVFPFSPSMVPYLQSTHRGHVADAAAEVAAAGPSSLLRA
FT                   DTKAEYDQLVTINLSELEPHINGPFTPDFSVPLSKFADTVREKKWPETFGAGLIGSCTN
FT                   SSYEDMTRAEDLVKQATAAGLKPKADFFITPGSEQIRATLDRDQTLNTFSEAGGVVLAN
FT                   ACGPCIGQWKRTDGVPKDEDNAIFTSYNRNFPGRNDGNRRTMNFLASPELVTALAYSGS
FT                   TTFNPMTDSLTTPDGSTFKFQPPSGFDLPSAGFEEGNPNFLPTAAVPDASAEVIVSPTS
FT                   DRLAILEPFEPFPKGDLSGLQVLYKVKGQCTTDTISAAGPWLKYKGHLPNISANTLIGA
FT                   VNAATGETNVAYDEAGNKYGIPELAEAWKERGISWLVVAEDNYGEGSAREHAALQPRYL
FT                   GGRVIVSKSFARIHETNLKKQGVVPLTFANREDYDRIDACDKVDTVGLYDVLQAGGQGE
FT                   IKLRVTKQKTGEVFDVPVQHTFSQDQCAFILAGSALNLLAKKAHS"
     MVSQLVWQRV SASRGMATRL SSQRLLARGL ATEASSSRMP PYPKLVRNLE QVRRVLGSDR        60
     ALTLAEKILY AHLDNAEESL LTGTNNGRDV RGKANLKLKP DRVAMQDASA QMALLQFMSC       120
     GLPSTAVPAS IHCDHMIVGE RGADTDLPAS IKGNSEVFDF LESAAKRYGI EFWPPGAGII       180
     HQSVLENYAA PGLMMLGTDS HTPNGGGLGA IAIGVGGADA VDALVDAPWE LKAPKILGVR       240
     LEGKLSGWAS PKDIILSLAG KLTVRGGTGS IIEYHGPGVE TLSCTGMATC CNMGAEVGAT       300
     TSVFPFSPSM VPYLQSTHRG HVADAAAEVA AAGPSSLLRA DTKAEYDQLV TINLSELEPH       360
     INGPFTPDFS VPLSKFADTV REKKWPETFG AGLIGSCTNS SYEDMTRAED LVKQATAAGL       420
     KPKADFFITP GSEQIRATLD RDQTLNTFSE AGGVVLANAC GPCIGQWKRT DGVPKDEDNA       480
     IFTSYNRNFP GRNDGNRRTM NFLASPELVT ALAYSGSTTF NPMTDSLTTP DGSTFKFQPP       540
     SGFDLPSAGF EEGNPNFLPT AAVPDASAEV IVSPTSDRLA ILEPFEPFPK GDLSGLQVLY       600
     KVKGQCTTDT ISAAGPWLKY KGHLPNISAN TLIGAVNAAT GETNVAYDEA GNKYGIPELA       660
     EAWKERGISW LVVAEDNYGE GSAREHAALQ PRYLGGRVIV SKSFARIHET NLKKQGVVPL       720
     TFANREDYDR IDACDKVDTV GLYDVLQAGG QGEIKLRVTK QKTGEVFDVP VQHTFSQDQC       780
     AFILAGSALN LLAKKAHS                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page