(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE312

PENCW_10.PE312       Location/Qualifiers
FT   CDS             join(complement(712696..713956),complement(711621..712642))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209649" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978074"
FT                   /orf_name="Pc13g03120"
FT                   /product="Pc13g03120 protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP91381.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0001830F79"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1U9"
FT                   /transl_table=1
FT                   /translation="MASHDQNQGTAYCPGDMKHRSVSPSPHGQQYHDPNSGGLGVDPSM
FT                   ASYSTNPSFQNPDSSIGGAEAYAYPSYLAGAPSTQTLSPPADHSYAPTINTNNLPISQS
FT                   FETSLVNQLEHSSTGLRPMQGDENFSNMLNSNHPELDFSLYQNHSPNSASTPEYDSSLL
FT                   LDPQMHQRQSINQAINPADLVSPISNPSVSSHPSSRDQQNSSPGPMSPPGSTPGAYYTP
FT                   RHSRHTSLDPATAAYLTAQPGPDWQSVMNNVSFQGHRRAPSEVSEVSSANHSPYLSQHE
FT                   FDGIENNASPSLVPQSDPSLYDNGLGMESFTLSEQHQQGISPLHSPYISPRLMPQQGGE
FT                   MVPNNSYLTQFPSAPTDMYGMPQEDMMNMNQLNNPPGDIGQASQMAPPSINVEFAPPLR
FT                   NPTVDTSKSTADFDSLSPPAMRSRVRSKSDPYHPASRSRSPATSSTSLEPRAPASPRSL
FT                   SPVGSVGSHSRSSPSSRDPSPSRSNRRLSTSSIENRNYILDLADPQRPGAAPGEPKRIQ
FT                   KHPATFQCTLCPKRFTRAYNLRSHLRTHTDERPFVCTVCGKAFARQHDRKRHEGLHSGE
FT                   KKFVCRGELSRSGQWGCGRRFARADALGRHFRSEAGRVCIKPLLDEESQERDRVLLERQ
FT                   QQQQQSPSGHLQPIPQPLVMPNMPGMDGQSTGNFVLPAALLAQYPALQTLQWDQISAVG
FT                   DDPGDIGGRSSFDASSGGEFGFDEDDSGMGGGYGNNQGGMYGVDNSGQMLGVNPGDPGY
FT                   SDQKWTG"
     MASHDQNQGT AYCPGDMKHR SVSPSPHGQQ YHDPNSGGLG VDPSMASYST NPSFQNPDSS        60
     IGGAEAYAYP SYLAGAPSTQ TLSPPADHSY APTINTNNLP ISQSFETSLV NQLEHSSTGL       120
     RPMQGDENFS NMLNSNHPEL DFSLYQNHSP NSASTPEYDS SLLLDPQMHQ RQSINQAINP       180
     ADLVSPISNP SVSSHPSSRD QQNSSPGPMS PPGSTPGAYY TPRHSRHTSL DPATAAYLTA       240
     QPGPDWQSVM NNVSFQGHRR APSEVSEVSS ANHSPYLSQH EFDGIENNAS PSLVPQSDPS       300
     LYDNGLGMES FTLSEQHQQG ISPLHSPYIS PRLMPQQGGE MVPNNSYLTQ FPSAPTDMYG       360
     MPQEDMMNMN QLNNPPGDIG QASQMAPPSI NVEFAPPLRN PTVDTSKSTA DFDSLSPPAM       420
     RSRVRSKSDP YHPASRSRSP ATSSTSLEPR APASPRSLSP VGSVGSHSRS SPSSRDPSPS       480
     RSNRRLSTSS IENRNYILDL ADPQRPGAAP GEPKRIQKHP ATFQCTLCPK RFTRAYNLRS       540
     HLRTHTDERP FVCTVCGKAF ARQHDRKRHE GLHSGEKKFV CRGELSRSGQ WGCGRRFARA       600
     DALGRHFRSE AGRVCIKPLL DEESQERDRV LLERQQQQQQ SPSGHLQPIP QPLVMPNMPG       660
     MDGQSTGNFV LPAALLAQYP ALQTLQWDQI SAVGDDPGDI GGRSSFDASS GGEFGFDEDD       720
     SGMGGGYGNN QGGMYGVDNS GQMLGVNPGD PGYSDQKWTG                             760
//

If you have problems or comments...

PBIL Back to PBIL home page