(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE314

PENCW_10.PE314       Location/Qualifiers
FT   CDS             complement(717368..720892)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209638" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129246"
FT                   /orf_name="Pc13g03140"
FT                   /product="Pc13g03140 protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP91383.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020657"
FT                   /db_xref="UniParc:UPI0001830F7B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1V1"
FT                   /transl_table=1
FT                   /translation="MTEIRSSQAGLEDPDQLARNRHASKNHKRNLSRSDESSQVPSASN
FT                   DHPESHPPSKSSAEQPSIITDVSEATATFRQAFPGLYGARTPSNRSSSSSLQALNEGIV
FT                   VDVRSENGSIGRTTRRASRHSDHQLPVYPDQSYASLQSQVHPTWHPPYLAEPDPLPRHS
FT                   YARGIRTAGNTPVSSPGLFSMRHSRMGTPSGSDDDVSTGSSLLHPSHLQPPKETHTAEV
FT                   DRDMVTGNKTINQYEILEELGRGEHGKVKLGQHVVTKQKVAIKIVQRYSTRRRLGKLGN
FT                   PEDKVKKEVAILKKARHPNVVSLLEVIDDPNRQKVYIVLEYVENGEIVWRKKGLREIVH
FT                   VDKLRLEREKNGIPDTPAFLEESHQFIRTAQHLRRQRERARERIEAQAADAQQGPIPAW
FT                   SLEHGAESSDEEDDESGLPIRRSSSRSIAVTDDSSPSFTQDPSLSAVEGSMYGAYSDYP
FT                   FERRSSTASSSFGYAPSEPEWSAEGDDMAFVPCLTIVEARSAFRDSVLGLEYLHYQGII
FT                   HRDIKPANLLVTSTHRVKISDFGVSYLGRPMRDEEEEQVGETDATELDDARELSKTVGT
FT                   PAFYAPELCYTGDDFVETIGSIPKITGAVDVWSLGVTLYGMIFGRLPFVSDDGYSMFQT
FT                   IVKKEVFIPRKRLVPVMDEASDSNQWNLRNDDELVYEDIDDELYDLLRRLLTKDPIKRI
FT                   TLKEIKHHPWTLHGLPNPRVWIEETDPGYQSKGKRIEVSNEEVTSAVSKVPFIQRVRSN
FT                   VAKWFGSRSKDKESRKRTSSTTPSTETLSSASSNNTFGKTSRDSRRSSLRGDEEFLRPL
FT                   KIGSQGHPLAQSVTASPVDEGDWASYFDAVQPAAAKLAAANKVATPPPAVTPRPGPPRR
FT                   AKSSMSTAESSKTVKPSGSDAPSTGRPFSIIEALGPTNFGSLFSGASRRASRGSRSRRS
FT                   SPSGESGSMHADGERCSAEPSVAVSNASAHGQVRTPGLWHEEEHPAAEQLVPSHVSRRK
FT                   RSSQLEDASPAESLNLTRDALLRRRRSDIDANEGGTLRVDYAMYSTESLLLPPINPPAN
FT                   QGCPDNTNNGLATSTSATISSSSADDFTSGMSQSASHPSIPSVISNASSLSGDGYSAKG
FT                   NNLDEVPSMLRTGETLKPLRPTSLRSSEEDESRYYCDDEDEDESEDEGLVIGKRKPPPK
FT                   AAASDIPS"
     MTEIRSSQAG LEDPDQLARN RHASKNHKRN LSRSDESSQV PSASNDHPES HPPSKSSAEQ        60
     PSIITDVSEA TATFRQAFPG LYGARTPSNR SSSSSLQALN EGIVVDVRSE NGSIGRTTRR       120
     ASRHSDHQLP VYPDQSYASL QSQVHPTWHP PYLAEPDPLP RHSYARGIRT AGNTPVSSPG       180
     LFSMRHSRMG TPSGSDDDVS TGSSLLHPSH LQPPKETHTA EVDRDMVTGN KTINQYEILE       240
     ELGRGEHGKV KLGQHVVTKQ KVAIKIVQRY STRRRLGKLG NPEDKVKKEV AILKKARHPN       300
     VVSLLEVIDD PNRQKVYIVL EYVENGEIVW RKKGLREIVH VDKLRLEREK NGIPDTPAFL       360
     EESHQFIRTA QHLRRQRERA RERIEAQAAD AQQGPIPAWS LEHGAESSDE EDDESGLPIR       420
     RSSSRSIAVT DDSSPSFTQD PSLSAVEGSM YGAYSDYPFE RRSSTASSSF GYAPSEPEWS       480
     AEGDDMAFVP CLTIVEARSA FRDSVLGLEY LHYQGIIHRD IKPANLLVTS THRVKISDFG       540
     VSYLGRPMRD EEEEQVGETD ATELDDAREL SKTVGTPAFY APELCYTGDD FVETIGSIPK       600
     ITGAVDVWSL GVTLYGMIFG RLPFVSDDGY SMFQTIVKKE VFIPRKRLVP VMDEASDSNQ       660
     WNLRNDDELV YEDIDDELYD LLRRLLTKDP IKRITLKEIK HHPWTLHGLP NPRVWIEETD       720
     PGYQSKGKRI EVSNEEVTSA VSKVPFIQRV RSNVAKWFGS RSKDKESRKR TSSTTPSTET       780
     LSSASSNNTF GKTSRDSRRS SLRGDEEFLR PLKIGSQGHP LAQSVTASPV DEGDWASYFD       840
     AVQPAAAKLA AANKVATPPP AVTPRPGPPR RAKSSMSTAE SSKTVKPSGS DAPSTGRPFS       900
     IIEALGPTNF GSLFSGASRR ASRGSRSRRS SPSGESGSMH ADGERCSAEP SVAVSNASAH       960
     GQVRTPGLWH EEEHPAAEQL VPSHVSRRKR SSQLEDASPA ESLNLTRDAL LRRRRSDIDA      1020
     NEGGTLRVDY AMYSTESLLL PPINPPANQG CPDNTNNGLA TSTSATISSS SADDFTSGMS      1080
     QSASHPSIPS VISNASSLSG DGYSAKGNNL DEVPSMLRTG ETLKPLRPTS LRSSEEDESR      1140
     YYCDDEDEDE SEDEGLVIGK RKPPPKAAAS DIPS                                  1174
//

If you have problems or comments...

PBIL Back to PBIL home page